BLASTX nr result
ID: Mentha25_contig00057311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00057311 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU80346.1| MIF domain-containing protein [Blumeria graminis... 69 5e-10 gb|EPQ64960.1| hypothetical protein BGT96224_4236 [Blumeria gram... 69 9e-10 >emb|CCU80346.1| MIF domain-containing protein [Blumeria graminis f. sp. hordei DH14] Length = 338 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/59 (55%), Positives = 42/59 (71%) Frame = +3 Query: 3 LPTHDEVITSTPSHLTSTSRNCTPIPERPPGVIIMEHRPDQVQKMGRHRNFIASIFGRA 179 LPTHDEV + S S R+CT + + G+I MEHR D+VQKMGR ++F+ASIFGRA Sbjct: 279 LPTHDEVAQNVSSPPISNDRHCTSLADLSNGMIYMEHRSDRVQKMGRRKSFMASIFGRA 337 >gb|EPQ64960.1| hypothetical protein BGT96224_4236 [Blumeria graminis f. sp. tritici 96224] Length = 338 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/59 (54%), Positives = 42/59 (71%) Frame = +3 Query: 3 LPTHDEVITSTPSHLTSTSRNCTPIPERPPGVIIMEHRPDQVQKMGRHRNFIASIFGRA 179 LPTHDEV + S S R+CT + + G+I M+HR D+VQKMGR ++F+ASIFGRA Sbjct: 279 LPTHDEVAPNVSSPPISNDRHCTSLADLSTGMIYMDHRSDRVQKMGRRKSFMASIFGRA 337