BLASTX nr result
ID: Mentha25_contig00057300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00057300 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 63 4e-08 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 63.2 bits (152), Expect = 4e-08 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 1/110 (0%) Frame = -3 Query: 334 LVECRGSLGAIGFERSGISKSFVVWVREGRSWLKLFD-TVLYGVERSLGLKDERFLFLEG 158 L++ GSLGAI + R G KS +WV G SW + F + GVER LG LFLE Sbjct: 268 LLDFNGSLGAIVYPREGTEKSIDLWVMNG-SWTRQFSIESVSGVERPLGFWKNGELFLE- 325 Query: 157 RTSSEELIQLLVYDCITKEQKEVDIYDYRYSLKVIPYVVDALPMHRRRKR 8 +S+ EL+ ++D T+E K + I+ Y+ ++++I YV +P++ R ++ Sbjct: 326 -SSNHELV---LFDPATRELKNLGIHAYQNTMQLIAYVESLVPINGRSEQ 371