BLASTX nr result
ID: Mentha25_contig00056482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00056482 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ65112.1| hypothetical protein BGT96224_A20523 [Blumeria gr... 92 6e-17 emb|CCU79001.1| hypothetical protein BGHDH14_bghG004172000002001... 90 3e-16 >gb|EPQ65112.1| hypothetical protein BGT96224_A20523 [Blumeria graminis f. sp. tritici 96224] Length = 317 Score = 92.4 bits (228), Expect = 6e-17 Identities = 46/60 (76%), Positives = 51/60 (85%) Frame = +1 Query: 4 MSEEEKSIIKKQAPFFRLVLTPTAEKGQSIYVQSRSNSMTASIAGEGNIETAHKSKTIDE 183 MSEEEK++IKKQAPFFRLVL+PT EKGQSIYVQSRSNS+TA I+GEG E A K K DE Sbjct: 247 MSEEEKAVIKKQAPFFRLVLSPTTEKGQSIYVQSRSNSLTAGISGEGKTEAAIKPKVHDE 306 >emb|CCU79001.1| hypothetical protein BGHDH14_bghG004172000002001 [Blumeria graminis f. sp. hordei DH14] Length = 296 Score = 90.1 bits (222), Expect = 3e-16 Identities = 45/60 (75%), Positives = 50/60 (83%) Frame = +1 Query: 4 MSEEEKSIIKKQAPFFRLVLTPTAEKGQSIYVQSRSNSMTASIAGEGNIETAHKSKTIDE 183 MSEEEK++IKKQAPFFRLVL+PT EKGQSIYVQSRSNS+T I+GEG E A K K DE Sbjct: 226 MSEEEKAVIKKQAPFFRLVLSPTTEKGQSIYVQSRSNSLTTGISGEGKPEAAIKPKVHDE 285