BLASTX nr result
ID: Mentha25_contig00056223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00056223 (763 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003297744.1| hypothetical protein PTT_08259 [Pyrenophora ... 50 9e-10 >ref|XP_003297744.1| hypothetical protein PTT_08259 [Pyrenophora teres f. teres 0-1] gi|311329395|gb|EFQ94161.1| hypothetical protein PTT_08259 [Pyrenophora teres f. teres 0-1] Length = 691 Score = 49.7 bits (117), Expect(3) = 9e-10 Identities = 23/60 (38%), Positives = 43/60 (71%) Frame = -2 Query: 435 LYREQPEENYSSSPNSILEALDQLLWSAQILANVVALLQSQVSTLQKTHKAIHTRRKREK 256 L RE+ + SSSP SI+EA+DQL A+++ +++ ++++L+KT+KA+ TR++ +K Sbjct: 587 LIRERVRRHKSSSPASIIEAIDQLKKGAEVMMLSAEVMRDRITSLEKTNKAVSTRKQCKK 646 Score = 32.0 bits (71), Expect(3) = 9e-10 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 3/78 (3%) Frame = -3 Query: 635 FLFSFPGFLNPAHINEGSRESDLFLSNPDAVLSKLE---SIPKSQGLPTNQIILVLMKLN 465 F +F PA+I R + L PD VLSKL+ P S LP + + + Sbjct: 519 FKAAFDQAFTPANIQSAFRGAGLVPLQPDTVLSKLDVQLRTPTSAALP--EALWEARTPS 576 Query: 464 NTQEIDKQDTYIENSLKR 411 N +E++ Q + I ++R Sbjct: 577 NVRELEAQSSLIRERVRR 594 Score = 27.7 bits (60), Expect(3) = 9e-10 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -1 Query: 724 F*PLKTAVSKQNLVLNRNHVFHVSE-DFLTNFYSAF 620 F PLK A S++ L R+H+ H+++ +FL F +AF Sbjct: 488 FSPLKRAYSREVESLIRHHINHITKLEFLPAFKAAF 523