BLASTX nr result
ID: Mentha25_contig00056167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00056167 (531 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU79777.1| nucleolar targeting protein [Blumeria graminis f... 65 1e-08 gb|ESZ92964.1| putative ribosomal large subunit biogenesis prote... 64 2e-08 gb|ELR08756.1| hypothetical protein GMDG_03435 [Pseudogymnoascus... 64 2e-08 ref|XP_007293584.1| hypothetical protein MBM_05695 [Marssonina b... 64 2e-08 ref|XP_001590018.1| 66S preribosome component MAK16 [Sclerotinia... 64 2e-08 ref|XP_001553326.1| 66S preribosome component MAK16 [Botryotinia... 64 2e-08 gb|EPQ63616.1| nuclear protein constituent of 66S pre-ribosomal ... 63 5e-08 gb|EPE29823.1| hypothetical protein GLAREA_00983 [Glarea lozoyen... 63 5e-08 gb|EHL03775.1| putative protein MAK16 [Glarea lozoyensis 74030] 63 5e-08 ref|XP_664216.1| hypothetical protein AN6612.2 [Aspergillus nidu... 60 4e-07 gb|EPS28588.1| hypothetical protein PDE_03534 [Penicillium oxali... 59 7e-07 gb|EKG21077.1| Mak16 protein [Macrophomina phaseolina MS6] 57 2e-06 ref|XP_007589659.1| putative ribosomal large subunit biogenesis ... 57 3e-06 gb|EYE96714.1| Mak16 protein [Aspergillus ruber CBS 135680] 57 4e-06 ref|XP_747652.1| ribosomal large subunit biogenesis protein MAK1... 57 4e-06 dbj|GAA90632.1| hypothetical protein AKAW_08746 [Aspergillus kaw... 57 4e-06 ref|XP_001396688.1| 66S preribosome component MAK16 [Aspergillus... 57 4e-06 ref|XP_001257630.1| 66S preribosome component MAK16 [Neosartorya... 57 4e-06 ref|XP_001270151.1| 66S preribosome component MAK16 [Aspergillus... 57 4e-06 gb|EZF36354.1| hypothetical protein H101_00112 [Trichophyton int... 56 5e-06 >emb|CCU79777.1| nucleolar targeting protein [Blumeria graminis f. sp. hordei DH14] Length = 323 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNVSESIWKKVLKGLER GEGTR Sbjct: 178 SGAYGDQPLNVSESIWKKVLKGLERAGEGTR 208 >gb|ESZ92964.1| putative ribosomal large subunit biogenesis protein MAK16 [Sclerotinia borealis F-4157] Length = 324 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNVSESIWKKVLKGLER GEGTR Sbjct: 178 SGAYGDQPLNVSESIWKKVLKGLERGGEGTR 208 >gb|ELR08756.1| hypothetical protein GMDG_03435 [Pseudogymnoascus destructans 20631-21] Length = 320 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNVSESIWKKVLKGLER GEGTR Sbjct: 178 SGAYGDQPLNVSESIWKKVLKGLERQGEGTR 208 >ref|XP_007293584.1| hypothetical protein MBM_05695 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406863353|gb|EKD16401.1| hypothetical protein MBM_05695 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 433 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNVSESIWKKVLKGLER GEGTR Sbjct: 282 SGAYGDQPLNVSESIWKKVLKGLERGGEGTR 312 >ref|XP_001590018.1| 66S preribosome component MAK16 [Sclerotinia sclerotiorum 1980 UF-70] gi|154693179|gb|EDN92917.1| hypothetical protein SS1G_08782 [Sclerotinia sclerotiorum 1980 UF-70] Length = 324 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNVSESIWKKVLKGLER GEGTR Sbjct: 178 SGAYGDQPLNVSESIWKKVLKGLERQGEGTR 208 >ref|XP_001553326.1| 66S preribosome component MAK16 [Botryotinia fuckeliana B05.10] gi|347833008|emb|CCD48705.1| hypothetical protein BofuT4_P033470.1 [Botryotinia fuckeliana T4] gi|472239970|gb|EMR84754.1| putative 66s preribosome component mak16 protein [Botryotinia fuckeliana BcDW1] Length = 325 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNVSESIWKKVLKGLER GEGTR Sbjct: 178 SGAYGDQPLNVSESIWKKVLKGLERQGEGTR 208 >gb|EPQ63616.1| nuclear protein constituent of 66S pre-ribosomal particles [Blumeria graminis f. sp. tritici 96224] Length = 319 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNVSESIWKKVLKGLER GEG R Sbjct: 178 SGAYGDQPLNVSESIWKKVLKGLERAGEGMR 208 >gb|EPE29823.1| hypothetical protein GLAREA_00983 [Glarea lozoyensis ATCC 20868] Length = 322 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNVSE+IWKKVLKGLER GEGTR Sbjct: 178 SGAYGDQPLNVSEAIWKKVLKGLERGGEGTR 208 >gb|EHL03775.1| putative protein MAK16 [Glarea lozoyensis 74030] Length = 198 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNVSE+IWKKVLKGLER GEGTR Sbjct: 54 SGAYGDQPLNVSEAIWKKVLKGLERGGEGTR 84 >ref|XP_664216.1| hypothetical protein AN6612.2 [Aspergillus nidulans FGSC A4] gi|40738951|gb|EAA58141.1| hypothetical protein AN6612.2 [Aspergillus nidulans FGSC A4] gi|259480191|tpe|CBF71096.1| TPA: ribosomal large subunit biogenesis protein MAK16, putative (AFU_orthologue; AFUA_6G04260) [Aspergillus nidulans FGSC A4] Length = 322 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNV ESIWKKVL+GLER GEG R Sbjct: 178 SGAYGDQPLNVDESIWKKVLRGLERSGEGER 208 >gb|EPS28588.1| hypothetical protein PDE_03534 [Penicillium oxalicum 114-2] Length = 319 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGDQPLNV E+IWKKVL+GLER GEG R Sbjct: 177 SGAYGDQPLNVDENIWKKVLRGLERAGEGER 207 >gb|EKG21077.1| Mak16 protein [Macrophomina phaseolina MS6] Length = 286 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYG+QPLNV E+IWKKVLKGLER GEG R Sbjct: 124 SGAYGEQPLNVDEAIWKKVLKGLERGGEGER 154 >ref|XP_007589659.1| putative ribosomal large subunit biogenesis protein [Neofusicoccum parvum UCRNP2] gi|485915164|gb|EOD42889.1| putative ribosomal large subunit biogenesis protein [Neofusicoccum parvum UCRNP2] Length = 342 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYG+QPLNV E++WKKVLKGLER GEG R Sbjct: 179 SGAYGEQPLNVDEAVWKKVLKGLERGGEGER 209 >gb|EYE96714.1| Mak16 protein [Aspergillus ruber CBS 135680] Length = 319 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGD+PLNV E IWKKVL+GLER GEG R Sbjct: 178 SGAYGDRPLNVEEGIWKKVLRGLERSGEGER 208 >ref|XP_747652.1| ribosomal large subunit biogenesis protein MAK16 [Aspergillus fumigatus Af293] gi|66845279|gb|EAL85614.1| ribosomal large subunit biogenesis protein MAK16, putative [Aspergillus fumigatus Af293] gi|159122439|gb|EDP47560.1| ribosomal large subunit biogenesis protein MAK16, putative [Aspergillus fumigatus A1163] Length = 324 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGD+PLNV E IWKKVL+GLER GEG R Sbjct: 178 SGAYGDRPLNVEEGIWKKVLRGLERTGEGER 208 >dbj|GAA90632.1| hypothetical protein AKAW_08746 [Aspergillus kawachii IFO 4308] Length = 330 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGD+PLNV E IWKKVL+GLER GEG R Sbjct: 178 SGAYGDRPLNVEEGIWKKVLRGLERSGEGER 208 >ref|XP_001396688.1| 66S preribosome component MAK16 [Aspergillus niger CBS 513.88] gi|134082207|emb|CAL00962.1| unnamed protein product [Aspergillus niger] gi|350636163|gb|EHA24523.1| hypothetical protein ASPNIDRAFT_210073 [Aspergillus niger ATCC 1015] Length = 329 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGD+PLNV E IWKKVL+GLER GEG R Sbjct: 178 SGAYGDRPLNVEEGIWKKVLRGLERSGEGER 208 >ref|XP_001257630.1| 66S preribosome component MAK16 [Neosartorya fischeri NRRL 181] gi|119405782|gb|EAW15733.1| ribosomal large subunit biogenesis protein MAK16, putative [Neosartorya fischeri NRRL 181] Length = 324 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGD+PLNV E IWKKVL+GLER GEG R Sbjct: 178 SGAYGDRPLNVEEGIWKKVLRGLERTGEGER 208 >ref|XP_001270151.1| 66S preribosome component MAK16 [Aspergillus clavatus NRRL 1] gi|119398295|gb|EAW08725.1| ribosomal large subunit biogenesis protein MAK16, putative [Aspergillus clavatus NRRL 1] Length = 323 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYGD+PLNV E IWKKVL+GLER GEG R Sbjct: 178 SGAYGDRPLNVEEGIWKKVLRGLERTGEGER 208 >gb|EZF36354.1| hypothetical protein H101_00112 [Trichophyton interdigitale H6] Length = 328 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 444 SGAYGDQPLNVSESIWKKVLKGLERCGEGTR 352 SGAYG+QPLNV E+IWKKVLKGLER G+G R Sbjct: 178 SGAYGEQPLNVQENIWKKVLKGLERQGDGER 208