BLASTX nr result
ID: Mentha25_contig00055975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00055975 (615 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ63399.1| hypothetical protein BGT96224_Ac31459 [Blumeria g... 60 4e-07 >gb|EPQ63399.1| hypothetical protein BGT96224_Ac31459 [Blumeria graminis f. sp. tritici 96224] Length = 73 Score = 60.5 bits (145), Expect = 4e-07 Identities = 33/72 (45%), Positives = 42/72 (58%) Frame = +3 Query: 300 VEIVRPVDEVSGRRGPGRPWKTLDLTIPDMSETWAKLKTTADMPISFTLNKSRLVTRNNQ 479 +EIV PV E + RRGPGRP K PD S TWAKL A++ FT + +R V R Q Sbjct: 1 MEIVDPVGETTTRRGPGRPHKIPAPATPDFSATWAKLTPAANVSAFFTQSNTRTVIRVAQ 60 Query: 480 SELNRVPECEIE 515 SE ++ E +E Sbjct: 61 SETSKASEDAME 72