BLASTX nr result
ID: Mentha25_contig00055940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00055940 (574 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 59 1e-06 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 58.5 bits (140), Expect = 1e-06 Identities = 45/137 (32%), Positives = 68/137 (49%), Gaps = 6/137 (4%) Frame = +2 Query: 179 HYLSVISPR---DFSMIADVDLPFLRNRNH-DVVGSSCRGLLHLHVFNGQSLVCNLSTKQ 346 HY S +S +FS+ ++ LPF N + VV C GLL LH G++ + N ST++ Sbjct: 75 HYFSALSTEKGENFSVTENIHLPFFENCWYAPVVSGPCNGLLCLHDA-GKAALWNPSTRE 133 Query: 347 MXXXXXXXXXCDP--DSVIFTGFGFRYDASSKDFIVIRNYSEHYESEEADEFGIHRYLGD 520 P DS F GF +D+ + D+ V+R + +Y E +E G+ ++ Sbjct: 134 FKILPRSSVNRPPSVDSTSFGCLGFGFDSITDDYKVVR-FVTNYFDENEEEGGLADWI-- 190 Query: 521 EEHTQLYSFGSGSWKEI 571 +LYS S SWKEI Sbjct: 191 -HQVELYSLKSDSWKEI 206