BLASTX nr result
ID: Mentha25_contig00055925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00055925 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001799928.1| hypothetical protein SNOG_09639 [Phaeosphaer... 60 4e-07 >ref|XP_001799928.1| hypothetical protein SNOG_09639 [Phaeosphaeria nodorum SN15] gi|111061784|gb|EAT82904.1| hypothetical protein SNOG_09639 [Phaeosphaeria nodorum SN15] Length = 753 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +2 Query: 185 ISPYTSRMVTLLFGQTKKPYYVSRDLLYNQTFITLNENEYDC-GYTEDIGHVLVHFMYTG 361 + PY VTL G +K Y+VS LL NQ +I + + + E+ GH+LVH++YTG Sbjct: 23 LRPYIVESVTLRIGPARKRYFVSSSLLQNQAWIESSRSRIELPDIDENTGHILVHYLYTG 82 Query: 362 TYQTL 376 TYQTL Sbjct: 83 TYQTL 87