BLASTX nr result
ID: Mentha25_contig00055831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00055831 (537 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU74756.1| ribosome biogenesis protein Urb1 [Blumeria grami... 58 1e-06 ref|XP_007294590.1| ribosome biogenesis protein Urb1 [Marssonina... 58 1e-06 gb|EPQ67780.1| hypothetical protein BGT96224_151 [Blumeria grami... 57 3e-06 >emb|CCU74756.1| ribosome biogenesis protein Urb1 [Blumeria graminis f. sp. hordei DH14] Length = 1134 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/54 (48%), Positives = 42/54 (77%) Frame = +3 Query: 6 IRNASSTLVTRFSIVTWLEIQEALSSNIVLKNLHQDLLKACNQKRIMRWSRRAI 167 I S+TL+TRFS +TWLE+Q+A++S+ LK+LH+ L+ + ++ RI +WS+ AI Sbjct: 1078 IDEGSTTLITRFSTLTWLEVQQAIASSPDLKSLHELLISSFDEDRIKQWSKGAI 1131 >ref|XP_007294590.1| ribosome biogenesis protein Urb1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406861888|gb|EKD14940.1| ribosome biogenesis protein Urb1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 1134 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = +3 Query: 6 IRNASSTLVTRFSIVTWLEIQEALSSNIVLKNLHQDLLKACNQKRIMRWSRRAITSK 176 I SSTLVTRFS +TWLE Q +L + LK L +L++C+QKR+ +WS+ A K Sbjct: 1072 IEGGSSTLVTRFSAMTWLEAQVSLGGGMPLKVLIDKILESCDQKRVKKWSKGAKKGK 1128 >gb|EPQ67780.1| hypothetical protein BGT96224_151 [Blumeria graminis f. sp. tritici 96224] Length = 1134 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/54 (48%), Positives = 41/54 (75%) Frame = +3 Query: 6 IRNASSTLVTRFSIVTWLEIQEALSSNIVLKNLHQDLLKACNQKRIMRWSRRAI 167 I S+TL+TRFS +TWLE+Q+AL+S+ LK+LH+ L+ + ++ RI +WS+ I Sbjct: 1078 IDEGSTTLITRFSTLTWLEVQQALASSPDLKSLHELLISSFDKDRIKQWSKGTI 1131