BLASTX nr result
ID: Mentha25_contig00055474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00055474 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGZ16405.1| MYB5 [Scutellaria baicalensis] 67 3e-09 gb|EYU37210.1| hypothetical protein MIMGU_mgv1a014332mg [Mimulus... 59 9e-07 >gb|AGZ16405.1| MYB5 [Scutellaria baicalensis] Length = 216 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 108 SRSARQISFGSPGSRSRHLDVERKKGTPWTEDEHRL 1 SR QISFGSPG+RSRH +VERKKGTPWTEDEHRL Sbjct: 100 SRMPGQISFGSPGNRSRHSEVERKKGTPWTEDEHRL 135 >gb|EYU37210.1| hypothetical protein MIMGU_mgv1a014332mg [Mimulus guttatus] Length = 193 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -1 Query: 93 QISFGSP--GSRSRHLDVERKKGTPWTEDEHRL 1 QISFGSP G+RSRH +V+RKKGTPWTEDEHRL Sbjct: 77 QISFGSPSSGNRSRHSEVDRKKGTPWTEDEHRL 109