BLASTX nr result
ID: Mentha25_contig00055422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00055422 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001942491.1| predicted protein [Pyrenophora tritici-repen... 69 7e-10 ref|XP_001937846.1| hypothetical protein PTRG_07514 [Pyrenophora... 67 3e-09 ref|XP_001936310.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001935883.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001942468.1| predicted protein [Pyrenophora tritici-repen... 67 3e-09 ref|XP_001942128.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001933438.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001933059.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001933025.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001932806.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001940974.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001932325.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001932112.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001931480.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001931466.1| conserved hypothetical protein [Pyrenophora ... 67 3e-09 ref|XP_001937171.1| conserved hypothetical protein [Pyrenophora ... 66 4e-09 ref|XP_002482946.1| hypothetical protein TSTA_126620 [Talaromyce... 66 6e-09 ref|XP_002487621.1| conserved hypothetical protein [Talaromyces ... 66 6e-09 ref|XP_003299924.1| hypothetical protein PTT_11032 [Pyrenophora ... 65 7e-09 ref|XP_003306266.1| hypothetical protein PTT_19388 [Pyrenophora ... 65 7e-09 >ref|XP_001942491.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187982577|gb|EDU48203.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 81 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +3 Query: 21 SRYYRWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 SR RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 17 SREIRWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 61 >ref|XP_001937846.1| hypothetical protein PTRG_07514 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984945|gb|EDU50433.1| hypothetical protein PTRG_07514 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 434 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 388 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 428 >ref|XP_001936310.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983409|gb|EDU48897.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1375 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 1329 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 1369 >ref|XP_001935883.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187982982|gb|EDU48470.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1518 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 1472 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 1512 >ref|XP_001942468.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980704|gb|EDU47330.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 201 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 155 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 195 >ref|XP_001942128.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979327|gb|EDU45953.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1504 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 1458 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 1498 >ref|XP_001933438.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979002|gb|EDU45628.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1426 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 1380 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 1420 >ref|XP_001933059.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978623|gb|EDU45249.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1442 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 1396 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 1436 >ref|XP_001933025.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978589|gb|EDU45215.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1426 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 1380 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 1420 >ref|XP_001932806.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978370|gb|EDU44996.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 902 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 856 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 896 >ref|XP_001940974.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977067|gb|EDU43693.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1464 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 1418 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 1458 >ref|XP_001932325.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973931|gb|EDU41430.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1519 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 1473 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 1513 >ref|XP_001932112.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973718|gb|EDU41217.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 842 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 796 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 836 >ref|XP_001931480.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973086|gb|EDU40585.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1221 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 1175 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 1215 >ref|XP_001931466.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973072|gb|EDU40571.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 752 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R+E WVQR Sbjct: 706 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVEGWVQR 746 >ref|XP_001937171.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984270|gb|EDU49758.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 1516 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ +++NEL R++ WVQR Sbjct: 1470 RWINGEDNPADAFTKASPNRALERFIDNNELTARVDGWVQR 1510 >ref|XP_002482946.1| hypothetical protein TSTA_126620 [Talaromyces stipitatus ATCC 10500] gi|218719534|gb|EED18954.1| hypothetical protein TSTA_126620 [Talaromyces stipitatus ATCC 10500] Length = 551 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWINGKDN AD+MTKS+PNK+LE+ +N+N L +R+E WV+R Sbjct: 510 RWINGKDNLADSMTKSTPNKALEQFLNENRLKVRVEGWVER 550 >ref|XP_002487621.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218712542|gb|EED11967.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 1671 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWINGKDN AD+MTKS+PNK+LE+ +N+N L +R+E WV+R Sbjct: 1630 RWINGKDNLADSMTKSTPNKALEQFLNENRLKVRVEGWVER 1670 >ref|XP_003299924.1| hypothetical protein PTT_11032 [Pyrenophora teres f. teres 0-1] gi|311326186|gb|EFQ91980.1| hypothetical protein PTT_11032 [Pyrenophora teres f. teres 0-1] Length = 182 Score = 65.5 bits (158), Expect = 7e-09 Identities = 25/41 (60%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R++ WVQR Sbjct: 136 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVDGWVQR 176 >ref|XP_003306266.1| hypothetical protein PTT_19388 [Pyrenophora teres f. teres 0-1] gi|311316271|gb|EFQ85638.1| hypothetical protein PTT_19388 [Pyrenophora teres f. teres 0-1] Length = 533 Score = 65.5 bits (158), Expect = 7e-09 Identities = 25/41 (60%), Positives = 36/41 (87%) Frame = +3 Query: 33 RWINGKDNPADAMTKSSPNKSLEKLVNDNELVIRLEAWVQR 155 RWING+DNPADA TK+SPN++LE+ ++ N+L +R++ WVQR Sbjct: 487 RWINGEDNPADAFTKASPNRALERFIDGNKLTVRVDGWVQR 527