BLASTX nr result
ID: Mentha25_contig00055236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00055236 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38130.1| hypothetical protein MIMGU_mgv1a015727mg [Mimulus... 55 8e-06 >gb|EYU38130.1| hypothetical protein MIMGU_mgv1a015727mg [Mimulus guttatus] Length = 148 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = -1 Query: 326 INGSERKEVAIHSAAMEDDDDMKPRRHW-PLLGVASNINEKSEAFIERKKKAMNQ 165 I+ E + A + ++ KP RHW PLL VASNINEKS+AFI RKKKAM + Sbjct: 85 ISADEEAKKANGNGGSHEETKEKPPRHWGPLLSVASNINEKSDAFINRKKKAMRR 139