BLASTX nr result
ID: Mentha25_contig00054498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00054498 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ66874.1| Subunit of the alpha-16 mannosyltransferase compl... 69 5e-10 emb|CCU75841.1| mannan polymerase II complex ANP1 subunit [Blume... 65 1e-08 >gb|EPQ66874.1| Subunit of the alpha-16 mannosyltransferase complex type II membrane protein [Blumeria graminis f. sp. tritici 96224] Length = 507 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/84 (40%), Positives = 53/84 (63%) Frame = +2 Query: 131 MLPRHNASNGQTSLRKELFKMSYSMSPYRYPNKSSPITSQNWKSVVKKIFILAAVMILFF 310 MLPRHNA G + +L K +Y +SP+RY ++S T++ + + K+ + +V++LF Sbjct: 1 MLPRHNAGTGYPRSKYDLGKNTYQISPHRYQPRTSS-TARRRRQTLIKLVVALSVVLLFI 59 Query: 311 LFIWPRFSIFSVLSFDLMTPQEEF 382 F+WP SIFSVLSF ++ Q F Sbjct: 60 FFLWPTSSIFSVLSFGFISSQGNF 83 >emb|CCU75841.1| mannan polymerase II complex ANP1 subunit [Blumeria graminis f. sp. hordei DH14] Length = 507 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/84 (36%), Positives = 50/84 (59%) Frame = +2 Query: 131 MLPRHNASNGQTSLRKELFKMSYSMSPYRYPNKSSPITSQNWKSVVKKIFILAAVMILFF 310 MLPRHNA G + ++ K +Y +SP+RY ++S T++ + + K+ + V++LF Sbjct: 1 MLPRHNAGTGYPRSKYDMGKNTYQISPHRYQPRTSS-TARRRRQTLIKLVVALTVVLLFI 59 Query: 311 LFIWPRFSIFSVLSFDLMTPQEEF 382 F+WP SIFS LSF ++ F Sbjct: 60 FFLWPTSSIFSALSFGFISSHGNF 83