BLASTX nr result
ID: Mentha25_contig00054483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00054483 (546 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ63233.1| hypothetical protein BGT96224_1960 [Blumeria gram... 64 2e-08 emb|CCU78019.1| hypothetical protein BGHDH14_bgh01551 [Blumeria ... 62 9e-08 ref|XP_007291419.1| hypothetical protein MBM_03530 [Marssonina b... 59 8e-07 >gb|EPQ63233.1| hypothetical protein BGT96224_1960 [Blumeria graminis f. sp. tritici 96224] Length = 355 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/62 (53%), Positives = 43/62 (69%) Frame = +3 Query: 3 KVSLRYTVKEFEKLYEESKKFMNRIKCSPIELEKVAYVLIIEQELSQKQKLLNNSQKSPD 182 KV LRYTV+EFEKL+E++ FM RIKC+P+ELEK A+V I E + + K +K P Sbjct: 155 KVPLRYTVQEFEKLFEKASDFMARIKCTPVELEKAAFVFINELDPPPEPK----PKKEPS 210 Query: 183 GL 188 GL Sbjct: 211 GL 212 >emb|CCU78019.1| hypothetical protein BGHDH14_bgh01551 [Blumeria graminis f. sp. hordei DH14] Length = 355 Score = 62.0 bits (149), Expect = 9e-08 Identities = 32/62 (51%), Positives = 42/62 (67%) Frame = +3 Query: 3 KVSLRYTVKEFEKLYEESKKFMNRIKCSPIELEKVAYVLIIEQELSQKQKLLNNSQKSPD 182 KV LRYTV+EFEKL+ ++ FM RIKC+P+ELEK A+V I E + + K +K P Sbjct: 155 KVPLRYTVQEFEKLFSKASDFMARIKCTPVELEKAAFVFINELDPPPEPK----PKKEPS 210 Query: 183 GL 188 GL Sbjct: 211 GL 212 >ref|XP_007291419.1| hypothetical protein MBM_03530 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865495|gb|EKD18537.1| hypothetical protein MBM_03530 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 382 Score = 58.9 bits (141), Expect = 8e-07 Identities = 30/71 (42%), Positives = 44/71 (61%) Frame = +3 Query: 3 KVSLRYTVKEFEKLYEESKKFMNRIKCSPIELEKVAYVLIIEQELSQKQKLLNNSQKSPD 182 KV + Y+ KEFE L++ + FM++IKC+PIELEKVA+VLI E E + K P Sbjct: 157 KVKITYSTKEFETLFKAAGNFMSKIKCTPIELEKVAFVLIKENEPVHEPKPKYEPSGRPR 216 Query: 183 GLTSPIRNDEK 215 G + +++K Sbjct: 217 GRPAMAESEKK 227