BLASTX nr result
ID: Mentha25_contig00054390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00054390 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU81943.1| Mitochondrial outer membrane protein iml2 [Blume... 69 7e-10 gb|EPQ67427.1| hypothetical protein BGT96224_2371 [Blumeria gram... 69 7e-10 ref|XP_007293704.1| breast cancer protein [Marssonina brunnea f.... 57 3e-06 >emb|CCU81943.1| Mitochondrial outer membrane protein iml2 [Blumeria graminis f. sp. hordei DH14] Length = 649 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -3 Query: 445 DHKKKILECKEWLEKVQNYSIPFVLDSRLSMKLTTSMATLKRHRRIMDI 299 DH K LEC W+EK+Q S PFVLD+RLSMK+ TS+ATLKRH+ I+ I Sbjct: 599 DHNAKTLECSNWIEKIQKLSDPFVLDTRLSMKVMTSVATLKRHKLILGI 647 >gb|EPQ67427.1| hypothetical protein BGT96224_2371 [Blumeria graminis f. sp. tritici 96224] Length = 649 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -3 Query: 445 DHKKKILECKEWLEKVQNYSIPFVLDSRLSMKLTTSMATLKRHRRIMDI 299 DH K LEC W+EK+Q S PFVLD+RLSMK+ TS+ATLKRH+ I+ I Sbjct: 599 DHNAKTLECSHWIEKIQKLSDPFVLDTRLSMKVMTSVATLKRHKLILGI 647 >ref|XP_007293704.1| breast cancer protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862755|gb|EKD15804.1| breast cancer protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 654 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = -3 Query: 445 DHKKKILECKEWLEKVQNYSIPFVLDSRLSMKLTTSMATLKRHRRIMDI 299 DH +K+LE + WL K Q + +VLDSR+S+K++TS T+ RH+R+M I Sbjct: 606 DHNEKVLESQSWLTKTQQWPDSYVLDSRVSVKVSTSAFTIDRHKRVMGI 654