BLASTX nr result
ID: Mentha25_contig00054297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00054297 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44174.1| hypothetical protein MIMGU_mgv1a006296mg [Mimulus... 74 3e-11 >gb|EYU44174.1| hypothetical protein MIMGU_mgv1a006296mg [Mimulus guttatus] Length = 449 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/71 (50%), Positives = 45/71 (63%) Frame = +1 Query: 1 NPNSEFSERHTPNHSGGYSQNVVYDPYHPSNVDPHSALFLPPQPRPPGVDPLYFPPVPPA 180 NPNS HT N+S GYS N DPY P VDPH+AL+ PQ +PPG++P Y PP Sbjct: 12 NPNSGVPLLHTVNYSAGYSHNPNSDPYQPPAVDPHNALY-QPQLQPPGLEPPYVPPA-MT 69 Query: 181 VNYVQQPLDFE 213 V Y QQP+ ++ Sbjct: 70 VEYAQQPISYQ 80