BLASTX nr result
ID: Mentha25_contig00053161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053161 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU76506.1| Cwf15/Cwc15 cell cycle control [Blumeria gramini... 83 5e-14 gb|EQL35825.1| hypothetical protein BDFG_02445 [Ajellomyces derm... 82 8e-14 gb|EGE81960.1| Cwf15/Cwc15 cell cycle control family protein [Aj... 82 8e-14 ref|XP_002621433.1| Cwf15/Cwc15 cell cycle control family protei... 82 8e-14 ref|XP_001247035.1| hypothetical protein CIMG_00806 [Coccidioide... 82 1e-13 gb|ESZ92656.1| hypothetical protein SBOR_6961 [Sclerotinia borea... 81 2e-13 gb|EON64424.1| hypothetical protein W97_03655 [Coniosporium apol... 81 2e-13 gb|EER45804.1| Cwf15/Cwc15 cell cycle control [Ajellomyces capsu... 81 2e-13 gb|EEH07653.1| Cwf15/Cwc15 cell cycle control family protein [Aj... 81 2e-13 gb|EZG04717.1| pre-mRNA-splicing factor cwc15 [Trichophyton rubr... 80 2e-13 gb|EZF32022.1| pre-mRNA-splicing factor cwc15 [Trichophyton inte... 80 2e-13 gb|EGE02872.1| pre-mRNA-splicing factor cwc15 [Trichophyton equi... 80 2e-13 gb|EGD93620.1| pre-mRNA splicing factor cwc15 [Trichophyton tons... 80 2e-13 ref|XP_003236420.1| pre-mRNA splicing factor cwc15 [Trichophyton... 80 2e-13 gb|EFW15585.1| pre-mRNA-splicing factor cwc15 [Coccidioides posa... 80 2e-13 ref|XP_002846676.1| Cwf15/Cwc15 cell cycle control family protei... 80 2e-13 gb|EMR89542.1| putative cwf15 cwc15 cell cycle control family pr... 80 4e-13 gb|EGY14640.1| pre-mRNA-splicing factor cwc15 [Verticillium dahl... 80 4e-13 ref|XP_001585318.1| hypothetical protein SS1G_13557 [Sclerotinia... 80 4e-13 ref|XP_001551167.1| hypothetical protein BC1G_10424 [Botryotinia... 80 4e-13 >emb|CCU76506.1| Cwf15/Cwc15 cell cycle control [Blumeria graminis f. sp. hordei DH14] Length = 236 Score = 82.8 bits (203), Expect = 5e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTENK KKEFVNDLLRSDFHKRFMSKYVR Sbjct: 197 DDDVIFKNQARGTENKGKKEFVNDLLRSDFHKRFMSKYVR 236 >gb|EQL35825.1| hypothetical protein BDFG_02445 [Ajellomyces dermatitidis ATCC 26199] Length = 240 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDVVFKNQARGTEN+ KKEFVNDLLRSDFHKRFMSKYVR Sbjct: 201 DDDVVFKNQARGTENRGKKEFVNDLLRSDFHKRFMSKYVR 240 >gb|EGE81960.1| Cwf15/Cwc15 cell cycle control family protein [Ajellomyces dermatitidis ATCC 18188] Length = 284 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR*YVTLCVWYSCNPKRY 190 DDDVVFKNQARGTEN+ KKEFVNDLLRSDFHKRFMSKYV + + +++ K Y Sbjct: 201 DDDVVFKNQARGTENRGKKEFVNDLLRSDFHKRFMSKYVSTPIRIFAFFASGRKFY 256 >ref|XP_002621433.1| Cwf15/Cwc15 cell cycle control family protein [Ajellomyces dermatitidis SLH14081] gi|239591261|gb|EEQ73842.1| Cwf15/Cwc15 cell cycle control family protein [Ajellomyces dermatitidis SLH14081] Length = 240 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDVVFKNQARGTEN+ KKEFVNDLLRSDFHKRFMSKYVR Sbjct: 201 DDDVVFKNQARGTENRGKKEFVNDLLRSDFHKRFMSKYVR 240 >ref|XP_001247035.1| hypothetical protein CIMG_00806 [Coccidioides immitis RS] Length = 236 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDVVFKNQARGTENK +KEFVNDLLRSDFHKRFMSKYVR Sbjct: 197 DDDVVFKNQARGTENKGQKEFVNDLLRSDFHKRFMSKYVR 236 >gb|ESZ92656.1| hypothetical protein SBOR_6961 [Sclerotinia borealis F-4157] Length = 235 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTE+K KKEFVNDLLRSDFHKRFMSKYVR Sbjct: 196 DDDVIFKNQARGTEDKGKKEFVNDLLRSDFHKRFMSKYVR 235 >gb|EON64424.1| hypothetical protein W97_03655 [Coniosporium apollinis CBS 100218] Length = 237 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDVVFKNQARGTE+K KKEFVNDLLRSDFHKRFMSKYVR Sbjct: 198 DDDVVFKNQARGTEDKKKKEFVNDLLRSDFHKRFMSKYVR 237 >gb|EER45804.1| Cwf15/Cwc15 cell cycle control [Ajellomyces capsulatus H143] gi|325088440|gb|EGC41750.1| Cwf15/Cwc15 cell cycle control family protein [Ajellomyces capsulatus H88] Length = 236 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDVVFKNQARGTEN+ KKEFVNDLLRSDFHKRFMSKYV+ Sbjct: 197 DDDVVFKNQARGTENRGKKEFVNDLLRSDFHKRFMSKYVK 236 >gb|EEH07653.1| Cwf15/Cwc15 cell cycle control family protein [Ajellomyces capsulatus G186AR] Length = 236 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDVVFKNQARGTEN+ KKEFVNDLLRSDFHKRFMSKYV+ Sbjct: 197 DDDVVFKNQARGTENRGKKEFVNDLLRSDFHKRFMSKYVK 236 >gb|EZG04717.1| pre-mRNA-splicing factor cwc15 [Trichophyton rubrum CBS 735.88] Length = 235 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTENK KEFVNDLLRSDFHKRFMSKYVR Sbjct: 196 DDDVIFKNQARGTENKGDKEFVNDLLRSDFHKRFMSKYVR 235 >gb|EZF32022.1| pre-mRNA-splicing factor cwc15 [Trichophyton interdigitale H6] Length = 235 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTENK KEFVNDLLRSDFHKRFMSKYVR Sbjct: 196 DDDVIFKNQARGTENKGDKEFVNDLLRSDFHKRFMSKYVR 235 >gb|EGE02872.1| pre-mRNA-splicing factor cwc15 [Trichophyton equinum CBS 127.97] Length = 235 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTENK KEFVNDLLRSDFHKRFMSKYVR Sbjct: 196 DDDVIFKNQARGTENKGDKEFVNDLLRSDFHKRFMSKYVR 235 >gb|EGD93620.1| pre-mRNA splicing factor cwc15 [Trichophyton tonsurans CBS 112818] Length = 235 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTENK KEFVNDLLRSDFHKRFMSKYVR Sbjct: 196 DDDVIFKNQARGTENKGDKEFVNDLLRSDFHKRFMSKYVR 235 >ref|XP_003236420.1| pre-mRNA splicing factor cwc15 [Trichophyton rubrum CBS 118892] gi|326461762|gb|EGD87215.1| pre-mRNA splicing factor cwc15 [Trichophyton rubrum CBS 118892] gi|607871071|gb|EZF16308.1| pre-mRNA-splicing factor cwc15 [Trichophyton rubrum MR850] gi|607902900|gb|EZF40444.1| pre-mRNA-splicing factor cwc15 [Trichophyton rubrum CBS 100081] gi|607914882|gb|EZF50952.1| pre-mRNA-splicing factor cwc15 [Trichophyton rubrum CBS 288.86] gi|607927034|gb|EZF61667.1| pre-mRNA-splicing factor cwc15 [Trichophyton rubrum CBS 289.86] gi|607938729|gb|EZF72056.1| pre-mRNA-splicing factor cwc15 [Trichophyton soudanense CBS 452.61] gi|607950804|gb|EZF82778.1| pre-mRNA-splicing factor cwc15 [Trichophyton rubrum MR1448] gi|607963134|gb|EZF93637.1| pre-mRNA-splicing factor cwc15 [Trichophyton rubrum MR1459] gi|607987189|gb|EZG15253.1| pre-mRNA-splicing factor cwc15 [Trichophyton rubrum CBS 202.88] Length = 235 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTENK KEFVNDLLRSDFHKRFMSKYVR Sbjct: 196 DDDVIFKNQARGTENKGDKEFVNDLLRSDFHKRFMSKYVR 235 >gb|EFW15585.1| pre-mRNA-splicing factor cwc15 [Coccidioides posadasii str. Silveira] Length = 236 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDVVFKNQARGTENK +KEFVNDLLRSDFHKRFMSKYV+ Sbjct: 197 DDDVVFKNQARGTENKGQKEFVNDLLRSDFHKRFMSKYVK 236 >ref|XP_002846676.1| Cwf15/Cwc15 cell cycle control family protein [Arthroderma otae CBS 113480] gi|238841932|gb|EEQ31594.1| Cwf15/Cwc15 cell cycle control family protein [Arthroderma otae CBS 113480] Length = 238 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTENK KEFVNDLLRSDFHKRFMSKYVR Sbjct: 199 DDDVIFKNQARGTENKGDKEFVNDLLRSDFHKRFMSKYVR 238 >gb|EMR89542.1| putative cwf15 cwc15 cell cycle control family protein [Botryotinia fuckeliana BcDW1] Length = 234 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTE+K KKEFVNDLLRSDFHK+FMSKYVR Sbjct: 195 DDDVIFKNQARGTEDKGKKEFVNDLLRSDFHKKFMSKYVR 234 >gb|EGY14640.1| pre-mRNA-splicing factor cwc15 [Verticillium dahliae VdLs.17] Length = 246 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDVVFKNQARGTE+K KKEF+NDLLRSDFHKRFM+KYVR Sbjct: 207 DDDVVFKNQARGTEDKGKKEFINDLLRSDFHKRFMNKYVR 246 >ref|XP_001585318.1| hypothetical protein SS1G_13557 [Sclerotinia sclerotiorum 1980] gi|154698960|gb|EDN98698.1| hypothetical protein SS1G_13557 [Sclerotinia sclerotiorum 1980 UF-70] Length = 240 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTE+K KKEFVNDLLRSDFHK+FMSKYVR Sbjct: 201 DDDVIFKNQARGTEDKGKKEFVNDLLRSDFHKKFMSKYVR 240 >ref|XP_001551167.1| hypothetical protein BC1G_10424 [Botryotinia fuckeliana B05.10] gi|347442049|emb|CCD34970.1| similar to Cwf15/Cwc15 cell cycle control family protein [Botryotinia fuckeliana T4] Length = 251 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 357 DDDVVFKNQARGTENKAKKEFVNDLLRSDFHKRFMSKYVR 238 DDDV+FKNQARGTE+K KKEFVNDLLRSDFHK+FMSKYVR Sbjct: 212 DDDVIFKNQARGTEDKGKKEFVNDLLRSDFHKKFMSKYVR 251