BLASTX nr result
ID: Mentha25_contig00052987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052987 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62975.1| rhomboid family protein [Genlisea aurea] 57 3e-06 >gb|EPS62975.1| rhomboid family protein [Genlisea aurea] Length = 317 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 1 EGDPLVSGAAHLGGATVGALAWLKHRKGRFGRF 99 EGDP +SGAAHLGGATV ALAW RKGRF RF Sbjct: 285 EGDPAISGAAHLGGATVAALAWALSRKGRFRRF 317