BLASTX nr result
ID: Mentha25_contig00052982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052982 (504 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUC26719.1| hypothetical protein COCCADRAFT_113570 [Bipolaris... 57 7e-08 gb|ENH98511.1| hypothetical protein COCC4DRAFT_155578, partial [... 56 5e-06 >gb|EUC26719.1| hypothetical protein COCCADRAFT_113570 [Bipolaris zeicola 26-R-13] Length = 119 Score = 57.4 bits (137), Expect(2) = 7e-08 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = +1 Query: 385 RGVEGRAPRYDRYLVDSASSHMLVSKIKPCMSKYKQV 495 R V YD YLVDSASSHMLVSKIKPCMSKYKQ+ Sbjct: 68 RTVNSAQSAYDCYLVDSASSHMLVSKIKPCMSKYKQL 104 Score = 25.0 bits (53), Expect(2) = 7e-08 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 239 RPILWGTQWGQSE 277 R WGTQWGQ E Sbjct: 17 RTASWGTQWGQFE 29 >gb|ENH98511.1| hypothetical protein COCC4DRAFT_155578, partial [Bipolaris maydis ATCC 48331] Length = 70 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 412 YDRYLVDSASSHMLVSKIKPCMSKYKQV 495 YD YLVDSASSHMLVSKIKPCMSKYKQ+ Sbjct: 28 YDCYLVDSASSHMLVSKIKPCMSKYKQL 55