BLASTX nr result
ID: Mentha25_contig00052964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052964 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41995.1| hypothetical protein MIMGU_mgv1a012823mg [Mimulus... 57 2e-06 >gb|EYU41995.1| hypothetical protein MIMGU_mgv1a012823mg [Mimulus guttatus] Length = 239 Score = 57.4 bits (137), Expect = 2e-06 Identities = 36/70 (51%), Positives = 39/70 (55%), Gaps = 20/70 (28%) Frame = +3 Query: 99 AYVRKRRRFSSWGSS--------------------RLCFGIGGEMKSRGGSSALAVKRAL 218 AYVRKRRRFSSWGSS CFGIG + KS GG S VK+A Sbjct: 169 AYVRKRRRFSSWGSSFDDRASAISSVRNDDVSPPANSCFGIGKD-KSDGGYSVFIVKKAF 227 Query: 219 LSIVGRGSAA 248 LSIVGRG A+ Sbjct: 228 LSIVGRGRAS 237