BLASTX nr result
ID: Mentha25_contig00052862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052862 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22020.1| hypothetical protein MIMGU_mgv1a004593mg [Mimulus... 70 3e-10 dbj|BAN66663.1| monogalactosyldiacylglycerol synthase 1 type A [... 60 3e-07 >gb|EYU22020.1| hypothetical protein MIMGU_mgv1a004593mg [Mimulus guttatus] Length = 519 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +1 Query: 226 MQPSTVSQESAKPIGFVSQLGNFALDASRLNPDGHSTCLSNYLYFDER 369 MQPSTV QE A P GFVSQ G+F ++SRLNPD STCLSN LYFD + Sbjct: 1 MQPSTVGQEPANPFGFVSQFGSFVFNSSRLNPDVLSTCLSNCLYFDAK 48 >dbj|BAN66663.1| monogalactosyldiacylglycerol synthase 1 type A [Sesamum indicum] Length = 516 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +1 Query: 226 MQPSTVSQESAKPIGFVSQLGNFALDASRLNPDGHSTCLSNYLYFDER 369 MQ STVSQE P GFVSQLG F +SR NPDG+ST LSN LY D R Sbjct: 1 MQASTVSQEPTNPFGFVSQLGYFV--SSRFNPDGNSTFLSNSLYLDAR 46