BLASTX nr result
ID: Mentha25_contig00052825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052825 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC04693.1| beta-ketoacyl-ACP synthase IIIA [Perilla frutescens] 75 7e-12 gb|EYU42405.1| hypothetical protein MIMGU_mgv1a007650mg [Mimulus... 64 2e-08 >gb|AAC04693.1| beta-ketoacyl-ACP synthase IIIA [Perilla frutescens] Length = 401 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -2 Query: 114 MANASGLFTPAAPSVGRRCSPCAGISRSGFWFSEGVSR 1 MANASGLFTPAAPSV RRCSPC GI RSGFWFSEGVSR Sbjct: 1 MANASGLFTPAAPSVRRRCSPCIGIYRSGFWFSEGVSR 38 >gb|EYU42405.1| hypothetical protein MIMGU_mgv1a007650mg [Mimulus guttatus] Length = 400 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/38 (78%), Positives = 30/38 (78%) Frame = -2 Query: 114 MANASGLFTPAAPSVGRRCSPCAGISRSGFWFSEGVSR 1 MANASGLF P PSV RR SPC GI RSGFWFSEG SR Sbjct: 1 MANASGLFNPVVPSVRRRFSPCTGIYRSGFWFSEGGSR 38