BLASTX nr result
ID: Mentha25_contig00052658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052658 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34455.1| hypothetical protein MIMGU_mgv1a002067mg [Mimulus... 67 3e-09 >gb|EYU34455.1| hypothetical protein MIMGU_mgv1a002067mg [Mimulus guttatus] Length = 719 Score = 67.0 bits (162), Expect = 3e-09 Identities = 38/78 (48%), Positives = 46/78 (58%), Gaps = 10/78 (12%) Frame = +2 Query: 113 KQIRLNPNLARLSSPFPFKSVFFCTSAPPQP--PSEIPNEELSIPEGPNHDSSSAETVA- 283 KQ N N+ +LSSPF KS+ FC++AP P P+ PNEEL + E P DSSSA A Sbjct: 8 KQPHFNSNITKLSSPFSIKSLLFCSAAPSPPPNPNPNPNEELPVSEIPIADSSSANATAA 67 Query: 284 -------YDRPLRRPKNP 316 + R LRRPKNP Sbjct: 68 EPPSPPTFRRQLRRPKNP 85