BLASTX nr result
ID: Mentha25_contig00052650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052650 (628 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70339.1| hypothetical protein M569_04420, partial [Genlise... 57 5e-06 gb|ACY82356.1| transcription factor cyclin D3c [Oreocharis dingh... 56 8e-06 >gb|EPS70339.1| hypothetical protein M569_04420, partial [Genlisea aurea] Length = 244 Score = 57.0 bits (136), Expect = 5e-06 Identities = 34/62 (54%), Positives = 42/62 (67%) Frame = +3 Query: 423 DEHLQSLFSKEREITSLRSTRFPSNVLIARKQGVEMVLRSSSLHGFSASAAILAVDFLDR 602 DE LQ+LFSK+ E + T S + RK+ VE VLR +S +GFSAS AILAV +LDR Sbjct: 16 DEELQTLFSKQEE-SFAGETAAVSGGDLPRKEAVEWVLRINSHYGFSASTAILAVSYLDR 74 Query: 603 FL 608 FL Sbjct: 75 FL 76 >gb|ACY82356.1| transcription factor cyclin D3c [Oreocharis dinghushanensis] Length = 286 Score = 56.2 bits (134), Expect = 8e-06 Identities = 31/65 (47%), Positives = 44/65 (67%), Gaps = 2/65 (3%) Frame = +3 Query: 423 DEHLQSLFSKEREIT--SLRSTRFPSNVLIARKQGVEMVLRSSSLHGFSASAAILAVDFL 596 DE L+SLF KE+E S S ++ +ARK+ VE +LR ++ +GFSA+ AILAVD+ Sbjct: 62 DEELESLFRKEKESCPESDNSVETICSLSLARKESVEWILRVNAYYGFSATTAILAVDYF 121 Query: 597 DRFLF 611 DR L+ Sbjct: 122 DRLLW 126