BLASTX nr result
ID: Mentha25_contig00052601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052601 (485 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34558.1| hypothetical protein MIMGU_mgv1a004664mg [Mimulus... 72 6e-11 gb|EPS66727.1| glycosyltransferase, partial [Genlisea aurea] 59 9e-07 >gb|EYU34558.1| hypothetical protein MIMGU_mgv1a004664mg [Mimulus guttatus] Length = 516 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 269 MKQLTALQQQGRRSNSFRNASSPLDATVDGAIKSPSTIFW 150 MKQLTALQQQ RRSNSFR+A+SPLDA VDG++KSP+TIFW Sbjct: 1 MKQLTALQQQARRSNSFRSAASPLDAAVDGSVKSPATIFW 40 >gb|EPS66727.1| glycosyltransferase, partial [Genlisea aurea] Length = 486 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -1 Query: 269 MKQLTALQQQGRRSNSFRNASSPLDATVDGAIKSPSTIFW 150 MKQLTALQQQGRRSNSFRN S +++ D IKSP+TIFW Sbjct: 1 MKQLTALQQQGRRSNSFRNLS---ESSADAVIKSPATIFW 37