BLASTX nr result
ID: Mentha25_contig00052555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052555 (529 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_198875.1| cysteine/histidine-rich C1 domain-containing pr... 67 6e-12 ref|XP_006286066.1| hypothetical protein CARUB_v10007599mg [Caps... 67 2e-11 ref|XP_006429892.1| hypothetical protein CICLE_v10013388mg, part... 66 2e-11 ref|NP_181967.1| cysteine/histidine-rich C1 domain-containing pr... 64 2e-11 ref|XP_006295416.1| hypothetical protein CARUB_v10024514mg [Caps... 67 3e-11 ref|XP_006397615.1| hypothetical protein EUTSA_v10001796mg [Eutr... 72 8e-11 ref|XP_006295388.1| hypothetical protein CARUB_v10024483mg [Caps... 72 8e-11 ref|XP_006359156.1| PREDICTED: uncharacterized protein LOC102597... 59 1e-10 emb|CAN66248.1| hypothetical protein VITISV_033018 [Vitis vinifera] 57 2e-10 ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing pr... 70 3e-10 ref|XP_002317723.2| DC1 domain-containing family protein [Populu... 64 3e-10 ref|XP_006369462.1| hypothetical protein POPTR_0001s23660g [Popu... 57 3e-10 pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thal... 63 4e-10 ref|NP_180394.1| cysteine/histidine-rich C1-like domain-containi... 63 4e-10 ref|NP_179365.1| cysteine/histidine-rich C1 domain-containing pr... 63 4e-10 ref|XP_006298947.1| hypothetical protein CARUB_v10015072mg [Caps... 63 4e-10 ref|XP_007048688.1| Binding protein, putative [Theobroma cacao] ... 56 6e-10 ref|XP_006295592.1| hypothetical protein CARUB_v10024700mg [Caps... 65 7e-10 ref|NP_199165.1| cysteine/histidine-rich C1 domain-containing pr... 61 7e-10 gb|EYU27145.1| hypothetical protein MIMGU_mgv1a023592mg, partial... 62 7e-10 >ref|NP_198875.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|9758085|dbj|BAB08529.1| unnamed protein product [Arabidopsis thaliana] gi|38454132|gb|AAR20760.1| At5g40590 [Arabidopsis thaliana] gi|38604024|gb|AAR24755.1| At5g40590 [Arabidopsis thaliana] gi|332007187|gb|AED94570.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 234 Score = 67.4 bits (163), Expect(2) = 6e-12 Identities = 36/89 (40%), Positives = 46/89 (51%), Gaps = 1/89 (1%) Frame = -2 Query: 522 ELGRATLCQSHLQHELRLL-KMSCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLPETF 346 EL R T +SH H L L+ ++ C+ACG + Y C+ C Y +H C S+PET Sbjct: 59 ELPRETNHKSHQPHTLTLIYSPKSTYTCNACGEYGSSFTYNCSICQYDVHVGCVSMPETV 118 Query: 345 KREDHDHKLFLSIYVPLEYIEYDFKCEVC 259 KREDH H L L P KC+VC Sbjct: 119 KREDHPHPLTLLYGSPYNQPGLVSKCDVC 147 Score = 28.5 bits (62), Expect(2) = 6e-12 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 235 WIYHCRLCRYAVHISCIFKKPTPRIFEDDEKG 140 W Y+C+ C YA H+ K+ + ++D+KG Sbjct: 156 WSYYCKECDYATHLHSCKKEEEAK--KEDQKG 185 >ref|XP_006286066.1| hypothetical protein CARUB_v10007599mg [Capsella rubella] gi|482554771|gb|EOA18964.1| hypothetical protein CARUB_v10007599mg [Capsella rubella] Length = 234 Score = 67.0 bits (162), Expect(2) = 2e-11 Identities = 36/89 (40%), Positives = 46/89 (51%), Gaps = 1/89 (1%) Frame = -2 Query: 522 ELGRATLCQSHLQHELRLL-KMSCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLPETF 346 +L R T +SH H L LL ++ C+ACG + Y C SC Y +H C S+PET Sbjct: 59 DLPRETNHKSHQPHTLTLLYSPKSTYTCNACGEYGSSFTYNCASCQYDVHVGCVSMPETV 118 Query: 345 KREDHDHKLFLSIYVPLEYIEYDFKCEVC 259 KRE+H H L L P KC+VC Sbjct: 119 KREEHAHPLTLLYGSPYNQPGLVSKCDVC 147 Score = 27.3 bits (59), Expect(2) = 2e-11 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 235 WIYHCRLCRYAVHISCIFKKPTPRIFEDDEKG 140 W Y+C+ C YA H+ K+ + E++ G Sbjct: 156 WSYYCKKCDYATHLHSCKKEEEAKKKEEEGGG 187 >ref|XP_006429892.1| hypothetical protein CICLE_v10013388mg, partial [Citrus clementina] gi|557531949|gb|ESR43132.1| hypothetical protein CICLE_v10013388mg, partial [Citrus clementina] Length = 399 Score = 65.9 bits (159), Expect(2) = 2e-11 Identities = 34/89 (38%), Positives = 46/89 (51%), Gaps = 4/89 (4%) Frame = -2 Query: 492 HLQHELRLLKMSCS----FRCDACGIKHTGKYYICTSCDYRIHHSCASLPETFKREDHDH 325 H H L LL M S F+C AC TG YY C C + H C++LP + + H H Sbjct: 73 HPSHFLNLLVMPSSVKGSFKCRACSQNVTGFYYNCGQCGFYYHILCSALPLSTSVKSHSH 132 Query: 324 KLFLSIYVPLEYIEYDFKCEVCRKDCWAG 238 L L +P YDF+C+ C+K C++G Sbjct: 133 PLELEFSLP-----YDFECDFCKKACYSG 156 Score = 28.1 bits (61), Expect(2) = 2e-11 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -1 Query: 235 WIYHCRLCRYAVHISC 188 W+Y C +C + H++C Sbjct: 157 WLYRCHICEFDAHLAC 172 >ref|NP_181967.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3128202|gb|AAC16106.1| unknown protein [Arabidopsis thaliana] gi|330255321|gb|AEC10415.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 209 Score = 63.9 bits (154), Expect(2) = 2e-11 Identities = 30/70 (42%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = -2 Query: 453 SFRCDACGIKHTGKYYICTSCDYRIHHSCASLPETFKREDHDHKLFLSIYVPLEYIEYD- 277 ++ CDACG +G Y C+ C Y +H CA +PET +REDH+H L L P + E Sbjct: 52 TYTCDACGEYGSGFTYNCSECQYDLHVGCAFIPETVEREDHEHPLTLLYNTPCKGCEDGA 111 Query: 276 -FKCEVCRKD 250 F C VC +D Sbjct: 112 MFICNVCEED 121 Score = 30.0 bits (66), Expect(2) = 2e-11 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 235 WIYHCRLCRYAVHI-SCIFKKPTPRIFEDDE 146 W+Y+C+ C Y H+ SC ++EDDE Sbjct: 127 WVYYCKECDYGTHVHSC-------AVYEDDE 150 >ref|XP_006295416.1| hypothetical protein CARUB_v10024514mg [Capsella rubella] gi|482564124|gb|EOA28314.1| hypothetical protein CARUB_v10024514mg [Capsella rubella] Length = 239 Score = 67.0 bits (162), Expect(2) = 3e-11 Identities = 38/96 (39%), Positives = 50/96 (52%), Gaps = 5/96 (5%) Frame = -2 Query: 522 ELGRATLCQSHLQHELRLLKMSC---SFRCDACGIKHTGKYYICTSCDYRIHHSCASLPE 352 +L R +SH H L L S + CDACG +G Y C++C Y +H CA +PE Sbjct: 63 DLPRELSHKSHPDHSLTLHHSSPYGQPYTCDACGEYGSGFTYHCSACQYDVHVGCAFIPE 122 Query: 351 TFKREDHDHKLFLSIYVPLEYIEYD--FKCEVCRKD 250 KREDH+H L L P + E F C+VC +D Sbjct: 123 NVKREDHEHPLTLLYNTPCKGREDGAMFICDVCEED 158 Score = 26.6 bits (57), Expect(2) = 3e-11 Identities = 8/17 (47%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = -1 Query: 235 WIYHCRLCRYAVHI-SC 188 W+Y+C+ C Y H+ SC Sbjct: 164 WVYYCKECDYGTHVHSC 180 >ref|XP_006397615.1| hypothetical protein EUTSA_v10001796mg [Eutrema salsugineum] gi|557098688|gb|ESQ39068.1| hypothetical protein EUTSA_v10001796mg [Eutrema salsugineum] Length = 247 Score = 72.0 bits (175), Expect = 8e-11 Identities = 38/88 (43%), Positives = 49/88 (55%), Gaps = 5/88 (5%) Frame = -2 Query: 498 QSHLQHELRLL---KMSCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLPETFKREDHD 328 +SHL H L LL S+ CDACG +G Y C+ C Y +H CA +PET +REDH+ Sbjct: 71 KSHLDHRLTLLYSPPYGHSYTCDACGEYGSGFTYNCSECQYDVHVGCAFIPETVEREDHE 130 Query: 327 HKLFLSIYVPLEYIEYD--FKCEVCRKD 250 H L L P + E F C+VC +D Sbjct: 131 HPLTLLYNTPCKGREDGAMFICDVCEED 158 >ref|XP_006295388.1| hypothetical protein CARUB_v10024483mg [Capsella rubella] gi|482564096|gb|EOA28286.1| hypothetical protein CARUB_v10024483mg [Capsella rubella] Length = 246 Score = 72.0 bits (175), Expect = 8e-11 Identities = 40/96 (41%), Positives = 52/96 (54%), Gaps = 5/96 (5%) Frame = -2 Query: 522 ELGRATLCQSHLQHELRLLKM---SCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLPE 352 +L R T +SH H L LL S+ CDACG +G Y C+ C Y +H CA +PE Sbjct: 63 DLPRETNHKSHPDHSLTLLHSPPYGQSYTCDACGEYGSGFTYNCSECQYDVHVGCAFIPE 122 Query: 351 TFKREDHDHKLFLSIYVPLEYIEYD--FKCEVCRKD 250 T +REDH+H L L P + E F C+VC +D Sbjct: 123 TVEREDHEHPLTLLYNTPCKGREDGAMFICDVCEED 158 >ref|XP_006359156.1| PREDICTED: uncharacterized protein LOC102597028 [Solanum tuberosum] Length = 266 Score = 58.9 bits (141), Expect(2) = 1e-10 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 4/83 (4%) Frame = -2 Query: 495 SHLQHELRLLKM----SCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLPETFKREDHD 328 SH H L LL SCSF C AC G + C C++ IH CASL + H Sbjct: 75 SHPSHPLTLLPSATYSSCSFTCKACDSAGNGFCFSCACCEFDIHLQCASLSSLILVDKHP 134 Query: 327 HKLFLSIYVPLEYIEYDFKCEVC 259 H+L L+ P E + ++ C++C Sbjct: 135 HQLELNFGSPYEDKDSEYVCDIC 157 Score = 32.7 bits (73), Expect(2) = 1e-10 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -1 Query: 235 WIYHCRLCRYAVHISCIFKKPTPRIFEDDEKGV 137 W+Y+C C +A H+ C+ P +F ++ V Sbjct: 166 WLYYCGGCDFASHLQCVITSPEVGVFAKQQRPV 198 >emb|CAN66248.1| hypothetical protein VITISV_033018 [Vitis vinifera] Length = 190 Score = 56.6 bits (135), Expect(2) = 2e-10 Identities = 38/95 (40%), Positives = 45/95 (47%), Gaps = 10/95 (10%) Frame = -2 Query: 498 QSHLQHELRLLKM----SCSFRCDACGIKHTGK--YYICTSCDYRIHHSCASLPETFKRE 337 +SH H L LL F CDAC +H G Y C +C Y +H CASLPET R Sbjct: 20 KSHPWHPLXLLSTPPYYGGGFTCDAC--RHGGHDFTYHCPTCHYDLHVGCASLPETVIRG 77 Query: 336 DHDHKLFLSIYVPLEYIEYDFKCEVCRKD----CW 244 DH H L L Y + F C+VC + CW Sbjct: 78 DHQHPLTL-FYCGYKEEGNTFICDVCHGNVPDGCW 111 Score = 34.7 bits (78), Expect(2) = 2e-10 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 235 WIYHCRLCRYAVHISCIFKKPTPRIFEDDEK 143 WIY+C+ C Y H+ C + +P E++E+ Sbjct: 111 WIYYCKSCDYGTHLGCATAEASPVAEEEEEE 141 >ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3128201|gb|AAC16105.1| unknown protein [Arabidopsis thaliana] gi|37202108|gb|AAQ89669.1| At2g44380 [Arabidopsis thaliana] gi|51971661|dbj|BAD44495.1| unknown protein [Arabidopsis thaliana] gi|330255320|gb|AEC10414.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 247 Score = 70.1 bits (170), Expect = 3e-10 Identities = 39/95 (41%), Positives = 51/95 (53%), Gaps = 5/95 (5%) Frame = -2 Query: 522 ELGRATLCQSHLQHELRLLKM---SCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLPE 352 +L R T +SH H L LL S+ CDACG +G Y C+ C Y +H CA +PE Sbjct: 63 DLPRETNHKSHPNHSLTLLHSPPYGQSYTCDACGEYGSGFTYNCSECQYDVHVGCAFIPE 122 Query: 351 TFKREDHDHKLFLSIYVPLEYIE--YDFKCEVCRK 253 T +REDH+H L L P + E F C+VC + Sbjct: 123 TVEREDHEHPLTLLYNTPCKGREDGAKFICDVCEE 157 >ref|XP_002317723.2| DC1 domain-containing family protein [Populus trichocarpa] gi|550326312|gb|EEE95943.2| DC1 domain-containing family protein [Populus trichocarpa] Length = 326 Score = 63.9 bits (154), Expect(2) = 3e-10 Identities = 27/67 (40%), Positives = 39/67 (58%) Frame = -2 Query: 453 SFRCDACGIKHTGKYYICTSCDYRIHHSCASLPETFKREDHDHKLFLSIYVPLEYIEYDF 274 SF CD CG++ G Y CT+CD+ +H CA+ P + + H H+L L+ Y P Y F Sbjct: 86 SFNCDGCGLQGNGFNYHCTTCDFDVHMMCATNPLSLAHQSHPHQLNLAFYPP--YQTKGF 143 Query: 273 KCEVCRK 253 C++C K Sbjct: 144 CCDICHK 150 Score = 26.2 bits (56), Expect(2) = 3e-10 Identities = 8/28 (28%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = -1 Query: 235 WIYHCRLCRYAVHISC---IFKKPTPRI 161 W+Y C C + H+ C + P P + Sbjct: 156 WLYRCSACEFDAHMKCAMSVNNTPLPHV 183 >ref|XP_006369462.1| hypothetical protein POPTR_0001s23660g [Populus trichocarpa] gi|550348011|gb|ERP66031.1| hypothetical protein POPTR_0001s23660g [Populus trichocarpa] Length = 321 Score = 57.4 bits (137), Expect(2) = 3e-10 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 4/82 (4%) Frame = -2 Query: 492 HLQHELRLLKMSCS----FRCDACGIKHTGKYYICTSCDYRIHHSCASLPETFKREDHDH 325 H H L LL F CDACG + G Y C +C+ IH +CA++P + H H Sbjct: 74 HQNHVLSLLSTPMYPGDLFNCDACGKQGNGFSYHCGTCNIYIHTTCAAMPLVLTHQSHHH 133 Query: 324 KLFLSIYVPLEYIEYDFKCEVC 259 +L L+ + P Y F C++C Sbjct: 134 QLNLTPFAP--YPNMSFSCDMC 153 Score = 32.7 bits (73), Expect(2) = 3e-10 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 235 WIYHCRLCRYAVHISCIFKKPTP 167 W+Y C LC + H+ C +P P Sbjct: 161 WLYRCNLCGFDAHLDCAVSQPNP 183 >pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thaliana Length = 457 Score = 62.8 bits (151), Expect(2) = 4e-10 Identities = 34/92 (36%), Positives = 48/92 (52%), Gaps = 4/92 (4%) Frame = -2 Query: 522 ELGRATLCQSHLQHELRLL----KMSCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLP 355 +L R +SH H L LL + ++ CDACG +G Y C+ C Y +H C S+P Sbjct: 267 DLPREIRHKSHPDHPLILLYSPQNNNSTYTCDACGEYGSGFTYNCSICQYDVHVGCVSVP 326 Query: 354 ETFKREDHDHKLFLSIYVPLEYIEYDFKCEVC 259 ET K ++H H L L P ++ F C+VC Sbjct: 327 ETMKHDEHVHPLALIYKAPCPK-DHIFTCDVC 357 Score = 26.9 bits (58), Expect(2) = 4e-10 Identities = 8/18 (44%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = -1 Query: 235 WIYHCRLCRYAVHI-SCI 185 W+Y+C+ C Y H+ SC+ Sbjct: 366 WLYYCQKCDYGAHLHSCV 383 >ref|NP_180394.1| cysteine/histidine-rich C1-like domain-containing protein [Arabidopsis thaliana] gi|4803954|gb|AAD29826.1| unknown protein [Arabidopsis thaliana] gi|330253004|gb|AEC08098.1| cysteine/histidine-rich C1-like domain-containing protein [Arabidopsis thaliana] Length = 248 Score = 63.2 bits (152), Expect(2) = 4e-10 Identities = 34/89 (38%), Positives = 45/89 (50%), Gaps = 6/89 (6%) Frame = -2 Query: 498 QSHLQHELRLLKMS----CSFRCDACGIKHTGKYYICTSCDYRIHHSCASLPETFKREDH 331 +SH H L LL ++ CDACG + Y C+ C Y +H CA +PE KREDH Sbjct: 70 KSHTNHPLTLLHSPPNGLSTYTCDACGEYGSAFTYHCSECKYHVHVGCAFVPENVKREDH 129 Query: 330 DHKLFLSIYVPLEYIE--YDFKCEVCRKD 250 +H L L P + + F C+VC D Sbjct: 130 EHPLTLLYNTPCKGRKDGVVFICDVCEVD 158 Score = 26.6 bits (57), Expect(2) = 4e-10 Identities = 8/17 (47%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = -1 Query: 235 WIYHCRLCRYAVHI-SC 188 W+Y+C+ C Y H+ SC Sbjct: 164 WVYYCKECDYGTHVHSC 180 >ref|NP_179365.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|25336186|pir||H84555 hypothetical protein At2g17740 [imported] - Arabidopsis thaliana gi|34146812|gb|AAQ62414.1| At2g17740 [Arabidopsis thaliana] gi|51968510|dbj|BAD42947.1| unknown protein [Arabidopsis thaliana] gi|51968940|dbj|BAD43162.1| unknown protein [Arabidopsis thaliana] gi|51971363|dbj|BAD44346.1| unknown protein [Arabidopsis thaliana] gi|51971715|dbj|BAD44522.1| unknown protein [Arabidopsis thaliana] gi|330251583|gb|AEC06677.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 248 Score = 62.8 bits (151), Expect(2) = 4e-10 Identities = 34/92 (36%), Positives = 48/92 (52%), Gaps = 4/92 (4%) Frame = -2 Query: 522 ELGRATLCQSHLQHELRLL----KMSCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLP 355 +L R +SH H L LL + ++ CDACG +G Y C+ C Y +H C S+P Sbjct: 58 DLPREIRHKSHPDHPLILLYSPQNNNSTYTCDACGEYGSGFTYNCSICQYDVHVGCVSVP 117 Query: 354 ETFKREDHDHKLFLSIYVPLEYIEYDFKCEVC 259 ET K ++H H L L P ++ F C+VC Sbjct: 118 ETMKHDEHVHPLALIYKAPCPK-DHIFTCDVC 148 Score = 26.9 bits (58), Expect(2) = 4e-10 Identities = 8/18 (44%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = -1 Query: 235 WIYHCRLCRYAVHI-SCI 185 W+Y+C+ C Y H+ SC+ Sbjct: 157 WLYYCQKCDYGAHLHSCV 174 >ref|XP_006298947.1| hypothetical protein CARUB_v10015072mg [Capsella rubella] gi|482567656|gb|EOA31845.1| hypothetical protein CARUB_v10015072mg [Capsella rubella] Length = 244 Score = 62.8 bits (151), Expect(2) = 4e-10 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 4/92 (4%) Frame = -2 Query: 522 ELGRATLCQSHLQHELRLL----KMSCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLP 355 +L R +SH H L LL + ++ C+ACG +G Y C++C Y +H C S+P Sbjct: 59 DLPREIRHKSHPNHPLTLLYSPQNNNSTYTCNACGEYGSGFTYNCSTCQYDVHVGCVSMP 118 Query: 354 ETFKREDHDHKLFLSIYVPLEYIEYDFKCEVC 259 ET K +H H L L +P ++ F C+VC Sbjct: 119 ETMKHSEHAHTLALIYSLPCPK-DHVFGCDVC 149 Score = 26.9 bits (58), Expect(2) = 4e-10 Identities = 8/23 (34%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 250 LLGRFWIYHCRLCRYAVHI-SCI 185 +L W+Y+C+ C + H+ SC+ Sbjct: 153 MLDNQWLYYCKTCDFGAHLHSCV 175 >ref|XP_007048688.1| Binding protein, putative [Theobroma cacao] gi|508700949|gb|EOX92845.1| Binding protein, putative [Theobroma cacao] Length = 202 Score = 55.8 bits (133), Expect(2) = 6e-10 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 12/97 (12%) Frame = -2 Query: 504 LCQSHLQHELRLLKMSCS---------FRCDACGIKHTGKYYICTSCDYRIHHSCASLPE 352 L H H LK+ C+ F C AC TG Y C++C + +H CA LP+ Sbjct: 69 LVLQHKSHPPHSLKLLCAPPDNYSRNIFICHACHDYGTGFDYHCSTCQFDLHVGCAKLPK 128 Query: 351 TFKREDHDHKLFLSIYVPLEYIEYD---FKCEVCRKD 250 T +DH H L++Y I+ + F C+VC +D Sbjct: 129 TINHKDHQH--LLTLYYSFSCIKENIEAFVCDVCGQD 163 Score = 33.5 bits (75), Expect(2) = 6e-10 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -1 Query: 256 QGLLGRFWIYHCRLCRYAVHISC 188 Q + R W+YHC+ C + +H+ C Sbjct: 162 QDVPDRLWVYHCKKCDFGIHLRC 184 >ref|XP_006295592.1| hypothetical protein CARUB_v10024700mg [Capsella rubella] gi|482564300|gb|EOA28490.1| hypothetical protein CARUB_v10024700mg [Capsella rubella] Length = 251 Score = 64.7 bits (156), Expect(2) = 7e-10 Identities = 36/93 (38%), Positives = 48/93 (51%), Gaps = 3/93 (3%) Frame = -2 Query: 522 ELGRATLCQSHLQHELRLL---KMSCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLPE 352 EL R T ++H H L LL ++ CDACG +G Y C+ C Y +H C S+PE Sbjct: 59 ELPRETRHKAHPDHPLTLLYSPPYESTYTCDACGEYGSGFTYNCSICQYDVHVGCVSMPE 118 Query: 351 TFKREDHDHKLFLSIYVPLEYIEYDFKCEVCRK 253 + +RE H H L L P E F C+VC + Sbjct: 119 SVEREGHRHPLTLLYRSPYEN-GLIFNCDVCEE 150 Score = 24.3 bits (51), Expect(2) = 7e-10 Identities = 8/17 (47%), Positives = 11/17 (64%), Gaps = 1/17 (5%) Frame = -1 Query: 235 WIYHCRLCRYAVHI-SC 188 W Y+C+ C Y H+ SC Sbjct: 157 WSYYCKECDYGTHLHSC 173 >ref|NP_199165.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|10178191|dbj|BAB11615.1| unnamed protein product [Arabidopsis thaliana] gi|332007593|gb|AED94976.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 250 Score = 61.2 bits (147), Expect(2) = 7e-10 Identities = 38/102 (37%), Positives = 49/102 (48%), Gaps = 9/102 (8%) Frame = -2 Query: 522 ELGRATLCQSHLQHELRLLKMSCSFR----CDACGIKHTGKYYICTSCDYRIHHSCASLP 355 +L T +SH H L LL R CDAC +G Y C++C+Y +H CA +P Sbjct: 67 DLPSETNNKSHQDHPLTLLHSPPDDRSVYTCDACDQYGSGFSYHCSNCNYSLHVGCAFIP 126 Query: 354 ETFKREDHDHKLFLSIYVPLEYIEYD-FKCEVC----RKDCW 244 ET REDH+H L L P + E F C C +D W Sbjct: 127 ETVDREDHEHPLTLLYCTPCKGREDTYFTCSACDETISEDLW 168 Score = 27.7 bits (60), Expect(2) = 7e-10 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 235 WIYHCRLCRYAVHI-SCIFKKPTPRIFED-DEKGVIHFPVYNV 113 W+Y+C+ C Y H+ SC + + ED DE+G P + Sbjct: 168 WMYYCKDCDYGTHLHSCAAYEDQGKEEEDEDEEGEASSPASRI 210 >gb|EYU27145.1| hypothetical protein MIMGU_mgv1a023592mg, partial [Mimulus guttatus] Length = 204 Score = 61.6 bits (148), Expect(2) = 7e-10 Identities = 38/102 (37%), Positives = 48/102 (47%), Gaps = 10/102 (9%) Frame = -2 Query: 498 QSHLQHELRLLK-----MSCSFRCDACGIKHTGKYYICTSCDYRIHHSCASLPETFKRED 334 +SH H LL + S C AC TG + C SCDY++H CA LPET + Sbjct: 68 KSHPDHVFTLLSELHPSSTTSLSCSACSDAVTGFAFQCDSCDYKMHVKCALLPETVECRA 127 Query: 333 HDHKLFLSIYVPLEYIEYD-----FKCEVCRKDCWAGSGYIT 223 H+HK L +Y I Y+ F C+VC D GY T Sbjct: 128 HEHK-HLDLYYSTSKIRYEEYSNVFSCDVCDGD--VAEGYWT 166 Score = 27.3 bits (59), Expect(2) = 7e-10 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 238 FWIYHCRLCRYAVHISC 188 +W Y+C+ C + H+ C Sbjct: 164 YWTYYCKECDFGAHLDC 180