BLASTX nr result
ID: Mentha25_contig00052395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052395 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ63801.1| hypothetical protein BGT96224_2682 [Blumeria gram... 64 2e-08 emb|CCU79318.1| hypothetical protein BGHDH14_bgh02402 [Blumeria ... 62 6e-08 >gb|EPQ63801.1| hypothetical protein BGT96224_2682 [Blumeria graminis f. sp. tritici 96224] Length = 620 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/84 (40%), Positives = 51/84 (60%), Gaps = 1/84 (1%) Frame = +1 Query: 13 FFYGIILLINVSQLLFIILTFLLAKRVKLGPLGFIGISLLLKPVSNSLPLSCEEEDNETT 192 FFY II LI + ILT L+ +VK+GP G IG+S+LLKPV++ L + D + Sbjct: 533 FFYLIIFLIVGFHFVLCILTAFLSNKVKVGPSGHIGMSILLKPVTDPLASISDGLDEKKL 592 Query: 193 RKILENTYALYEKD-SSENRWSIK 261 R NTY +YE++ ++ RW+ + Sbjct: 593 RDAKRNTYIIYERNMENQGRWNFR 616 >emb|CCU79318.1| hypothetical protein BGHDH14_bgh02402 [Blumeria graminis f. sp. hordei DH14] Length = 620 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 1/84 (1%) Frame = +1 Query: 13 FFYGIILLINVSQLLFIILTFLLAKRVKLGPLGFIGISLLLKPVSNSLPLSCEEEDNETT 192 FFY II LI + ILT L+ +VK+GP G IG+S+LLKPV++ L + D + Sbjct: 533 FFYLIIFLIVGFHFVLCILTAFLSNKVKVGPTGHIGMSILLKPVTDPLASISDGLDEKKL 592 Query: 193 RKILENTYALYEKD-SSENRWSIK 261 R NT+ +YE++ + RW+ + Sbjct: 593 RDAKRNTFIIYERNMEKQGRWNFR 616