BLASTX nr result
ID: Mentha25_contig00052374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052374 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC25937.1| hypothetical protein, partial [Piper DNA virus 1] 62 8e-08 >gb|AGC25937.1| hypothetical protein, partial [Piper DNA virus 1] Length = 2027 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = -1 Query: 343 EKSQIIYTCMNTEI-ECQHDWIRFKGNNHVSCFICKLFPAIDKRYQCNKCFREICFLCIN 167 E I Y +N ++ +C H+W + KG++ C C L+P + +RY+C C +EICF+CI Sbjct: 549 EPFSIQYGLINEQMKDCIHNWEQGKGSDSTPCSNCTLYPELRRRYRCANCMQEICFICIK 608 Query: 166 ENFKINTEL 140 + + I+T L Sbjct: 609 KLYNIDTNL 617