BLASTX nr result
ID: Mentha25_contig00052200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052200 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA28209.1| hypothetical protein ACLA_058020 [Albugo laibach... 50 5e-11 >emb|CCA28209.1| hypothetical protein ACLA_058020 [Albugo laibachii Nc14] Length = 375 Score = 50.4 bits (119), Expect(2) = 5e-11 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 1/70 (1%) Frame = +2 Query: 95 KTSKLE*ESLQSSRIRSQDVTEHHTDP*K*T*ANRGFLLNPFLIYKHDL-MFEKISDPIR 271 K K + + LQSS + Q + +HT+P K T + + FLL+ FL+ KH L +E + DP R Sbjct: 195 KDFKKQWKHLQSSIVDPQSLLRYHTNPSKWTCSCQAFLLSRFLLCKHILCCYEFVPDPAR 254 Query: 272 FFLQVLGQRY 301 FF +V QRY Sbjct: 255 FFREVRRQRY 264 Score = 42.4 bits (98), Expect(2) = 5e-11 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = +3 Query: 3 WLIVSRVASQAVERMMALLNKKHRVVTACWRK 98 W+IVSRVA QA+ERM ALL R A WRK Sbjct: 164 WVIVSRVAPQAIERMKALLKDDRRTGKAAWRK 195