BLASTX nr result
ID: Mentha25_contig00052090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00052090 (511 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ62975.1| Zn-ribbon protein [Blumeria graminis f. sp. triti... 98 1e-18 emb|CCU82925.1| diphthamide biosynthesis protein 3 [Blumeria gra... 95 9e-18 ref|XP_007290507.1| diphthamide biosynthesis protein [Marssonina... 93 3e-17 gb|ESZ95764.1| diphthamide biosynthesis protein 3 [Sclerotinia b... 93 4e-17 ref|XP_001588286.1| hypothetical protein SS1G_10733 [Sclerotinia... 93 4e-17 ref|XP_001546403.1| hypothetical protein BC1G_15090 [Botryotinia... 93 4e-17 ref|XP_002584448.1| diphthamide biosynthesis protein 3 [Uncinoca... 92 6e-17 ref|XP_001247687.1| hypothetical protein CIMG_01458 [Coccidioide... 92 1e-16 gb|EME88159.1| hypothetical protein MYCFIDRAFT_209726 [Pseudocer... 91 1e-16 ref|XP_003065758.1| hypothetical protein CPC735_049830 [Coccidio... 91 2e-16 ref|XP_001213190.1| diphthamide biosynthesis protein 3 [Aspergil... 91 2e-16 gb|EWC47646.1| diphthamide biosynthesis protein 3 [Drechslerella... 91 2e-16 gb|EAS36225.2| diphthamide biosynthesis protein 3 [Coccidioides ... 91 2e-16 ref|XP_003232307.1| diphthamide biosynthesis protein 3 [Trichoph... 91 2e-16 gb|EEH45478.1| diphthamide biosynthesis protein [Paracoccidioide... 91 2e-16 ref|XP_002795133.1| diphthamide biosynthesis protein [Paracoccid... 91 2e-16 gb|EEH20865.1| diphthamide biosynthesis protein [Paracoccidioide... 91 2e-16 ref|XP_002844485.1| diphthamide biosynthesis protein 3 [Arthrode... 90 3e-16 gb|ERF70507.1| Diphthamide biosynthesis protein 3 [Endocarpon pu... 90 4e-16 gb|EQL30368.1| diphthamide biosynthesis protein 3 [Ajellomyces d... 90 4e-16 >gb|EPQ62975.1| Zn-ribbon protein [Blumeria graminis f. sp. tritici 96224] Length = 84 Score = 97.8 bits (242), Expect = 1e-18 Identities = 41/62 (66%), Positives = 50/62 (80%) Frame = +3 Query: 120 MERNIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVV 299 ME NIYD +E+EDMT+DPVL IYHYPCPCGDRFEI +D+ DN+ I C SCSL I+V+ Sbjct: 1 MEENIYDEIEIEDMTYDPVLEIYHYPCPCGDRFEIGIADLRDNQDIGVCPSCSLMIRVIF 60 Query: 300 NL 305 +L Sbjct: 61 DL 62 >emb|CCU82925.1| diphthamide biosynthesis protein 3 [Blumeria graminis f. sp. hordei DH14] Length = 84 Score = 95.1 bits (235), Expect = 9e-18 Identities = 40/62 (64%), Positives = 49/62 (79%) Frame = +3 Query: 120 MERNIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVV 299 ME NIYD +E+EDMT+D VL IYHYPCPCGDRFEI +D+ DN+ I C SCSL I+V+ Sbjct: 1 MEENIYDEIEIEDMTYDAVLEIYHYPCPCGDRFEIGVADLRDNQDIGVCPSCSLMIRVIY 60 Query: 300 NL 305 +L Sbjct: 61 DL 62 >ref|XP_007290507.1| diphthamide biosynthesis protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866341|gb|EKD19381.1| diphthamide biosynthesis protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 86 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/59 (66%), Positives = 48/59 (81%) Frame = +3 Query: 120 MERNIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVV 296 M NIYD +E+EDMT+DPVL IYHYPCPCGDRFEI +++ D+E IA C SCSL I+V+ Sbjct: 1 MAENIYDEIEIEDMTYDPVLEIYHYPCPCGDRFEIGIAELRDSEDIAVCPSCSLMIRVI 59 >gb|ESZ95764.1| diphthamide biosynthesis protein 3 [Sclerotinia borealis F-4157] Length = 81 Score = 92.8 bits (229), Expect = 4e-17 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = +3 Query: 120 MERNIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVV 296 M NIYD +E+EDMT+DPVL IYHYPCPCGDRFEI +D+ D E I C SCSL I+V+ Sbjct: 1 MAENIYDEIEIEDMTYDPVLQIYHYPCPCGDRFEIGIADLRDGEDIGVCPSCSLMIKVI 59 >ref|XP_001588286.1| hypothetical protein SS1G_10733 [Sclerotinia sclerotiorum 1980] gi|154695120|gb|EDN94858.1| hypothetical protein SS1G_10733 [Sclerotinia sclerotiorum 1980 UF-70] Length = 81 Score = 92.8 bits (229), Expect = 4e-17 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = +3 Query: 120 MERNIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVV 296 M NIYD +E+EDMT+DPVL IYHYPCPCGDRFEI +D+ D E I C SCSL I+V+ Sbjct: 1 MAENIYDEIEIEDMTYDPVLQIYHYPCPCGDRFEIGIADLRDGEDIGVCPSCSLMIKVI 59 >ref|XP_001546403.1| hypothetical protein BC1G_15090 [Botryotinia fuckeliana B05.10] gi|347835098|emb|CCD49670.1| similar to diphthamide biosynthesis protein 3 [Botryotinia fuckeliana T4] gi|472242245|gb|EMR86944.1| putative diphthamide biosynthesis protein 3 protein [Botryotinia fuckeliana BcDW1] Length = 81 Score = 92.8 bits (229), Expect = 4e-17 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = +3 Query: 120 MERNIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVV 296 M NIYD +E+EDMT+DPVL IYHYPCPCGDRFEI +D+ D E I C SCSL I+V+ Sbjct: 1 MAENIYDEIEIEDMTYDPVLQIYHYPCPCGDRFEIGIADLRDGEDIGVCPSCSLMIKVI 59 >ref|XP_002584448.1| diphthamide biosynthesis protein 3 [Uncinocarpus reesii 1704] gi|237905894|gb|EEP80295.1| diphthamide biosynthesis protein 3 [Uncinocarpus reesii 1704] Length = 84 Score = 92.4 bits (228), Expect = 6e-17 Identities = 39/59 (66%), Positives = 49/59 (83%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVVNL 305 +IYD +E+EDMTFDPVL IYHYPCPCGDRFEI +D+ D+E IA C SCSL I+V+ ++ Sbjct: 6 SIYDEIEIEDMTFDPVLQIYHYPCPCGDRFEIGIADLRDSEEIAICPSCSLMIRVIFDV 64 >ref|XP_001247687.1| hypothetical protein CIMG_01458 [Coccidioides immitis RS] Length = 73 Score = 91.7 bits (226), Expect = 1e-16 Identities = 38/60 (63%), Positives = 48/60 (80%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVVNLI 308 +IYD +E+EDMTFDP L IYHYPCPCGDRFEI +D+ D E IA C SCSL I+V+ +++ Sbjct: 6 SIYDEIEIEDMTFDPALQIYHYPCPCGDRFEIGIADLRDGEEIAICPSCSLMIKVIFDVV 65 >gb|EME88159.1| hypothetical protein MYCFIDRAFT_209726 [Pseudocercospora fijiensis CIRAD86] Length = 89 Score = 91.3 bits (225), Expect = 1e-16 Identities = 38/61 (62%), Positives = 46/61 (75%) Frame = +3 Query: 123 ERNIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVVN 302 E NIYD +E+EDMTFD +YHYPCPCGDRFEIN D+ D E IA C SCSL I+V+ + Sbjct: 3 EENIYDEIEIEDMTFDETTQLYHYPCPCGDRFEINVDDLRDGEEIAVCPSCSLQIRVIFD 62 Query: 303 L 305 + Sbjct: 63 V 63 >ref|XP_003065758.1| hypothetical protein CPC735_049830 [Coccidioides posadasii C735 delta SOWgp] gi|240105420|gb|EER23613.1| hypothetical protein CPC735_049830 [Coccidioides posadasii C735 delta SOWgp] gi|320039632|gb|EFW21566.1| CSL family zinc finger protein [Coccidioides posadasii str. Silveira] Length = 84 Score = 90.9 bits (224), Expect = 2e-16 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVVNL 305 +IYD VE+EDMTFDP L IYHYPCPCGDRFEI +D+ D E IA C SCSL I+V+ ++ Sbjct: 6 SIYDEVEIEDMTFDPALQIYHYPCPCGDRFEIGIADLRDGEEIAICPSCSLMIKVIFDV 64 >ref|XP_001213190.1| diphthamide biosynthesis protein 3 [Aspergillus terreus NIH2624] gi|114194114|gb|EAU35814.1| diphthamide biosynthesis protein 3 [Aspergillus terreus NIH2624] Length = 84 Score = 90.9 bits (224), Expect = 2e-16 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVVNL 305 +IYD +E+EDMTFDP L IYHYPCPCGDRFEI D+ D E IA C SCSL I+V+ +L Sbjct: 7 SIYDEIEIEDMTFDPTLQIYHYPCPCGDRFEIAIDDLRDGEDIAVCPSCSLMIRVIFDL 65 >gb|EWC47646.1| diphthamide biosynthesis protein 3 [Drechslerella stenobrocha 248] Length = 82 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/62 (61%), Positives = 48/62 (77%) Frame = +3 Query: 120 MERNIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVV 299 ME +IYD +E+EDMTFDPVL I+HYPCPCGDRFEI D+ + E IA C CSL I+V+ Sbjct: 1 MEESIYDEIEIEDMTFDPVLQIFHYPCPCGDRFEIAIGDLREGEDIAVCPGCSLMIRVIY 60 Query: 300 NL 305 ++ Sbjct: 61 DV 62 >gb|EAS36225.2| diphthamide biosynthesis protein 3 [Coccidioides immitis RS] Length = 84 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/59 (64%), Positives = 47/59 (79%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVVNL 305 +IYD +E+EDMTFDP L IYHYPCPCGDRFEI +D+ D E IA C SCSL I+V+ ++ Sbjct: 6 SIYDEIEIEDMTFDPALQIYHYPCPCGDRFEIGIADLRDGEEIAICPSCSLMIKVIFDV 64 >ref|XP_003232307.1| diphthamide biosynthesis protein 3 [Trichophyton rubrum CBS 118892] gi|326465479|gb|EGD90932.1| diphthamide biosynthesis protein 3 [Trichophyton rubrum CBS 118892] gi|326473966|gb|EGD97975.1| diphthamide biosynthesis protein 3 [Trichophyton tonsurans CBS 112818] gi|326480965|gb|EGE04975.1| diphthamide biosynthesis protein 3 [Trichophyton equinum CBS 127.97] gi|607881534|gb|EZF26297.1| diphthamide biosynthesis protein 3 [Trichophyton rubrum MR850] gi|607889657|gb|EZF29961.1| diphthamide biosynthesis protein 3 [Trichophyton interdigitale H6] gi|607908290|gb|EZF45331.1| diphthamide biosynthesis protein 3 [Trichophyton rubrum CBS 100081] gi|607920367|gb|EZF55994.1| diphthamide biosynthesis protein 3 [Trichophyton rubrum CBS 288.86] gi|607932383|gb|EZF66579.1| diphthamide biosynthesis protein 3 [Trichophyton rubrum CBS 289.86] gi|607944286|gb|EZF77188.1| diphthamide biosynthesis protein 3 [Trichophyton soudanense CBS 452.61] gi|607956421|gb|EZF87877.1| diphthamide biosynthesis protein 3 [Trichophyton rubrum MR1448] gi|607968614|gb|EZF98660.1| diphthamide biosynthesis protein 3 [Trichophyton rubrum MR1459] gi|607980796|gb|EZG09734.1| diphthamide biosynthesis protein 3 [Trichophyton rubrum CBS 735.88] gi|607992600|gb|EZG20173.1| diphthamide biosynthesis protein 3 [Trichophyton rubrum CBS 202.88] Length = 84 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVV 296 +IYD +E+EDMTFDPVL IYHYPCPCGDRFEI +D+ D E I C SCSL I+V+ Sbjct: 6 SIYDEIEIEDMTFDPVLQIYHYPCPCGDRFEIGLADLRDGEDIGVCPSCSLMIRVI 61 >gb|EEH45478.1| diphthamide biosynthesis protein [Paracoccidioides brasiliensis Pb18] Length = 90 Score = 90.5 bits (223), Expect = 2e-16 Identities = 37/59 (62%), Positives = 47/59 (79%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVVNL 305 +IYD +E+EDMT+DP L IYHYPCPCGDRFEI +D+ D E IA C SCSL ++V+ +L Sbjct: 8 SIYDEIEIEDMTYDPTLQIYHYPCPCGDRFEIGIADLRDGEEIAVCPSCSLMVRVIFDL 66 >ref|XP_002795133.1| diphthamide biosynthesis protein [Paracoccidioides sp. 'lutzii' Pb01] gi|226285067|gb|EEH40633.1| diphthamide biosynthesis protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 217 Score = 90.5 bits (223), Expect = 2e-16 Identities = 37/59 (62%), Positives = 47/59 (79%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVVNL 305 +IYD +E+EDMT+DP L IYHYPCPCGDRFEI +D+ D E IA C SCSL ++V+ +L Sbjct: 135 SIYDEIEIEDMTYDPTLQIYHYPCPCGDRFEIGIADLRDGEEIAVCPSCSLMVRVIFDL 193 >gb|EEH20865.1| diphthamide biosynthesis protein [Paracoccidioides brasiliensis Pb03] Length = 534 Score = 90.5 bits (223), Expect = 2e-16 Identities = 37/59 (62%), Positives = 47/59 (79%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVVNL 305 +IYD +E+EDMT+DP L IYHYPCPCGDRFEI +D+ D E IA C SCSL ++V+ +L Sbjct: 415 SIYDEIEIEDMTYDPTLQIYHYPCPCGDRFEIGIADLRDGEEIAVCPSCSLMVRVIFDL 473 >ref|XP_002844485.1| diphthamide biosynthesis protein 3 [Arthroderma otae CBS 113480] gi|238843968|gb|EEQ33630.1| diphthamide biosynthesis protein 3 [Arthroderma otae CBS 113480] Length = 84 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVV 296 +IYD +E+EDMTFDPVL IYHYPCPCGDRFEI +D+ D E I C SCSL I+V+ Sbjct: 6 SIYDEIEIEDMTFDPVLQIYHYPCPCGDRFEIGLADLRDGEEIGICPSCSLMIRVI 61 >gb|ERF70507.1| Diphthamide biosynthesis protein 3 [Endocarpon pusillum Z07020] Length = 84 Score = 89.7 bits (221), Expect = 4e-16 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVV 296 NIYD +E+EDMTFD +L IYHYPCPCGDRFEI +D+ D E IA C SCSL I+V+ Sbjct: 6 NIYDEIEIEDMTFDKMLQIYHYPCPCGDRFEIGIADLRDGEEIAVCPSCSLMIKVI 61 >gb|EQL30368.1| diphthamide biosynthesis protein 3 [Ajellomyces dermatitidis ATCC 26199] Length = 84 Score = 89.7 bits (221), Expect = 4e-16 Identities = 36/59 (61%), Positives = 47/59 (79%) Frame = +3 Query: 129 NIYDVVELEDMTFDPVLNIYHYPCPCGDRFEINASDILDNETIATCMSCSLAIQVVVNL 305 +IYD +E+EDMT+DP L IYHYPCPCGDRFEI +D+ D E IA C SCSL ++V+ ++ Sbjct: 8 SIYDEIEIEDMTYDPTLQIYHYPCPCGDRFEIGIADLRDGEEIAVCPSCSLMVRVIFDM 66