BLASTX nr result
ID: Mentha25_contig00050948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050948 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38623.1| hypothetical protein L484_014437 [Morus notabilis] 109 4e-22 emb|CAJ34815.1| amino acid permease [Plantago major] 108 6e-22 ref|XP_004291933.1| PREDICTED: lysine histidine transporter-like... 107 1e-21 ref|XP_006354939.1| PREDICTED: lysine histidine transporter-like... 107 2e-21 ref|XP_007017387.1| Transmembrane amino acid transporter family ... 107 2e-21 ref|XP_007017386.1| Transmembrane amino acid transporter family ... 107 2e-21 ref|XP_006434873.1| hypothetical protein CICLE_v10000841mg [Citr... 106 4e-21 ref|XP_002284114.1| PREDICTED: lysine histidine transporter-like... 106 4e-21 emb|CAN78281.1| hypothetical protein VITISV_021650 [Vitis vinifera] 106 4e-21 ref|XP_006375013.1| amino acid transporter family protein [Popul... 105 5e-21 ref|XP_006473395.1| PREDICTED: lysine histidine transporter-like... 105 7e-21 ref|XP_004238196.1| PREDICTED: lysine histidine transporter-like... 105 9e-21 ref|XP_004485720.1| PREDICTED: lysine histidine transporter-like... 104 1e-20 ref|XP_003593467.1| Lysine/histidine transporter [Medicago trunc... 104 1e-20 ref|XP_007222812.1| hypothetical protein PRUPE_ppa004223mg [Prun... 103 2e-20 ref|XP_002510286.1| amino acid transporter, putative [Ricinus co... 103 3e-20 ref|XP_003545851.1| PREDICTED: lysine histidine transporter-like... 102 4e-20 ref|XP_004141237.1| PREDICTED: lysine histidine transporter-like... 101 1e-19 gb|EYU45070.1| hypothetical protein MIMGU_mgv1a004478mg [Mimulus... 100 2e-19 ref|XP_003543081.1| PREDICTED: lysine histidine transporter-like... 100 4e-19 >gb|EXB38623.1| hypothetical protein L484_014437 [Morus notabilis] Length = 521 Score = 109 bits (273), Expect = 4e-22 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIKKPTKYSFNWY NWILGWLGIAFSLAFSIGG+WSMVNSGLKLKFFKPN Sbjct: 471 VLIKKPTKYSFNWYFNWILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKPN 521 >emb|CAJ34815.1| amino acid permease [Plantago major] Length = 136 Score = 108 bits (271), Expect = 6e-22 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIKKPTKY+FNWY NWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN Sbjct: 86 VLIKKPTKYTFNWYFNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 136 >ref|XP_004291933.1| PREDICTED: lysine histidine transporter-like 8-like [Fragaria vesca subsp. vesca] Length = 521 Score = 107 bits (268), Expect = 1e-21 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP 152 VLIKKPTKYSFNWY NWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP Sbjct: 470 VLIKKPTKYSFNWYFNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP 519 >ref|XP_006354939.1| PREDICTED: lysine histidine transporter-like 8-like [Solanum tuberosum] Length = 525 Score = 107 bits (267), Expect = 2e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIKKPTKYSFNWY NWILGWLG+AFSLAFSIGGIWSMVN+GLKL+FFKPN Sbjct: 475 VLIKKPTKYSFNWYFNWILGWLGVAFSLAFSIGGIWSMVNNGLKLRFFKPN 525 >ref|XP_007017387.1| Transmembrane amino acid transporter family protein isoform 2 [Theobroma cacao] gi|508722715|gb|EOY14612.1| Transmembrane amino acid transporter family protein isoform 2 [Theobroma cacao] Length = 488 Score = 107 bits (267), Expect = 2e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIK+PTKYSFNWY NWILGWLGIAFSLAFSIGG+WSMVN+GLKLKFFKPN Sbjct: 438 VLIKRPTKYSFNWYFNWILGWLGIAFSLAFSIGGVWSMVNNGLKLKFFKPN 488 >ref|XP_007017386.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] gi|508722714|gb|EOY14611.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] Length = 520 Score = 107 bits (267), Expect = 2e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIK+PTKYSFNWY NWILGWLGIAFSLAFSIGG+WSMVN+GLKLKFFKPN Sbjct: 470 VLIKRPTKYSFNWYFNWILGWLGIAFSLAFSIGGVWSMVNNGLKLKFFKPN 520 >ref|XP_006434873.1| hypothetical protein CICLE_v10000841mg [Citrus clementina] gi|557536995|gb|ESR48113.1| hypothetical protein CICLE_v10000841mg [Citrus clementina] Length = 526 Score = 106 bits (264), Expect = 4e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIKKPTKYSFNWY NWILGWLG+AFSLAFSIGGIWS+VNSGLKLKFFKP+ Sbjct: 476 VLIKKPTKYSFNWYFNWILGWLGVAFSLAFSIGGIWSIVNSGLKLKFFKPS 526 >ref|XP_002284114.1| PREDICTED: lysine histidine transporter-like 8 [Vitis vinifera] gi|302142384|emb|CBI19587.3| unnamed protein product [Vitis vinifera] Length = 514 Score = 106 bits (264), Expect = 4e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIKKPTK+SFNWY NWILGWLGIAFSLAFSIGG+WSMVNSGLKLKFFKP+ Sbjct: 464 VLIKKPTKFSFNWYFNWILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKPS 514 >emb|CAN78281.1| hypothetical protein VITISV_021650 [Vitis vinifera] Length = 493 Score = 106 bits (264), Expect = 4e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIKKPTK+SFNWY NWILGWLGIAFSLAFSIGG+WSMVNSGLKLKFFKP+ Sbjct: 443 VLIKKPTKFSFNWYFNWILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKPS 493 >ref|XP_006375013.1| amino acid transporter family protein [Populus trichocarpa] gi|550323327|gb|ERP52810.1| amino acid transporter family protein [Populus trichocarpa] Length = 521 Score = 105 bits (263), Expect = 5e-21 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP 152 VLIKKP+KYSFNWY NWILGWLGIAFSLAFSIGG+WSMVNSGLKLKFFKP Sbjct: 470 VLIKKPSKYSFNWYFNWILGWLGIAFSLAFSIGGVWSMVNSGLKLKFFKP 519 >ref|XP_006473395.1| PREDICTED: lysine histidine transporter-like 8-like [Citrus sinensis] Length = 526 Score = 105 bits (262), Expect = 7e-21 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIKKPTKYSFNWY NWILGWLG+AFSLAFSIGG+WS+VNSGLKLKFFKP+ Sbjct: 476 VLIKKPTKYSFNWYFNWILGWLGVAFSLAFSIGGLWSIVNSGLKLKFFKPS 526 >ref|XP_004238196.1| PREDICTED: lysine histidine transporter-like 8-like [Solanum lycopersicum] Length = 525 Score = 105 bits (261), Expect = 9e-21 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIKKPTKYSFNWY NWILGWLG+AFSLAFSIGGIWSMV +GLKL+FFKPN Sbjct: 475 VLIKKPTKYSFNWYFNWILGWLGVAFSLAFSIGGIWSMVTNGLKLRFFKPN 525 >ref|XP_004485720.1| PREDICTED: lysine histidine transporter-like 8-like [Cicer arietinum] Length = 520 Score = 104 bits (260), Expect = 1e-20 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIK+PTKYSF+WY NWILGWLG+AFSLAFSIGGIWSMVN GLKLKFFKPN Sbjct: 470 VLIKQPTKYSFSWYFNWILGWLGVAFSLAFSIGGIWSMVNDGLKLKFFKPN 520 >ref|XP_003593467.1| Lysine/histidine transporter [Medicago truncatula] gi|355482515|gb|AES63718.1| Lysine/histidine transporter [Medicago truncatula] Length = 520 Score = 104 bits (260), Expect = 1e-20 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIK+PTKYSF+WY NWILGWLG+AFSLAFSIGGIWSMVN GLKLKFFKPN Sbjct: 470 VLIKQPTKYSFSWYFNWILGWLGVAFSLAFSIGGIWSMVNDGLKLKFFKPN 520 >ref|XP_007222812.1| hypothetical protein PRUPE_ppa004223mg [Prunus persica] gi|462419748|gb|EMJ24011.1| hypothetical protein PRUPE_ppa004223mg [Prunus persica] Length = 522 Score = 103 bits (258), Expect = 2e-20 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP 152 VLIKKPTKYSFNWY +WILGWLGI FSLAFSIGG+WSMVNSGLKLKFFKP Sbjct: 471 VLIKKPTKYSFNWYFHWILGWLGIVFSLAFSIGGVWSMVNSGLKLKFFKP 520 >ref|XP_002510286.1| amino acid transporter, putative [Ricinus communis] gi|223550987|gb|EEF52473.1| amino acid transporter, putative [Ricinus communis] Length = 521 Score = 103 bits (257), Expect = 3e-20 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP 152 VLIK+P+KYSFNWY NWILGWLGIAFSLAFSIGG+WSMVNSGL+LKFFKP Sbjct: 470 VLIKRPSKYSFNWYFNWILGWLGIAFSLAFSIGGVWSMVNSGLRLKFFKP 519 >ref|XP_003545851.1| PREDICTED: lysine histidine transporter-like 8-like isoform X1 [Glycine max] gi|571516573|ref|XP_006597400.1| PREDICTED: lysine histidine transporter-like 8-like isoform X2 [Glycine max] Length = 516 Score = 102 bits (255), Expect = 4e-20 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIK+P KYSFNWY NWILGWLG+AFSLAFSIGGIWS+VN GLKLKFFKPN Sbjct: 466 VLIKQPPKYSFNWYFNWILGWLGVAFSLAFSIGGIWSIVNDGLKLKFFKPN 516 >ref|XP_004141237.1| PREDICTED: lysine histidine transporter-like 8-like [Cucumis sativus] Length = 520 Score = 101 bits (252), Expect = 1e-19 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIKKPTK+SFNWY +W LGWLGIAFSLAFSIGGIWS+VNSGLKLKFFKP+ Sbjct: 470 VLIKKPTKFSFNWYFHWTLGWLGIAFSLAFSIGGIWSLVNSGLKLKFFKPS 520 >gb|EYU45070.1| hypothetical protein MIMGU_mgv1a004478mg [Mimulus guttatus] Length = 525 Score = 100 bits (249), Expect = 2e-19 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +3 Query: 6 LIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP 152 LIKKP KYSF+WY +W+LGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP Sbjct: 475 LIKKPVKYSFDWYLSWVLGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKP 523 >ref|XP_003543081.1| PREDICTED: lysine histidine transporter-like 8-like [Glycine max] Length = 516 Score = 99.8 bits (247), Expect = 4e-19 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +3 Query: 3 VLIKKPTKYSFNWYCNWILGWLGIAFSLAFSIGGIWSMVNSGLKLKFFKPN 155 VLIK+P KYSFNWY NWILGWLG+ FSLAFSIGGIWS+VN GLK KFFKPN Sbjct: 466 VLIKQPPKYSFNWYFNWILGWLGVGFSLAFSIGGIWSIVNDGLKFKFFKPN 516