BLASTX nr result
ID: Mentha25_contig00050723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050723 (471 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK64102.1| gag-pol polyprotein [Eustoma exaltatum subsp. ru... 57 3e-06 >dbj|BAK64102.1| gag-pol polyprotein [Eustoma exaltatum subsp. russellianum] Length = 1591 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = -3 Query: 298 MDKSKLWC*HCGKQKHTRETCFLLVGFPEWWEEK 197 MDKS L C HCGK+ H+RE CF + G+PEWWE K Sbjct: 295 MDKSNLLCEHCGKKGHSREKCFQIHGYPEWWEGK 328