BLASTX nr result
ID: Mentha25_contig00050426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050426 (686 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU76215.1| hypothetical protein BGHDH14_bghG002265000001001... 56 1e-05 >emb|CCU76215.1| hypothetical protein BGHDH14_bghG002265000001001 [Blumeria graminis f. sp. hordei DH14] Length = 116 Score = 56.2 bits (134), Expect = 1e-05 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 685 ARPIGPKITATVVDKCMGCSGMDIDISPAAFK 590 AR PKI ATV+DKCMGC+GMD+D+SPAAFK Sbjct: 84 ARTPSPKIVATVMDKCMGCNGMDVDLSPAAFK 115