BLASTX nr result
ID: Mentha25_contig00050041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050041 (555 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39550.1| hypothetical protein MIMGU_mgv1a001504mg [Mimulus... 58 2e-06 >gb|EYU39550.1| hypothetical protein MIMGU_mgv1a001504mg [Mimulus guttatus] Length = 806 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 11/59 (18%) Frame = -2 Query: 155 MVVAENDPLKSLLNSVQV---AFSPLGSNFQNLAKNLEHCFDGVVK--------NEASS 12 MVV+ NDPL+S NS+QV AFSP+ S FQ +AKN EHCF G K N+ASS Sbjct: 1 MVVSGNDPLESFFNSIQVVTDAFSPIQSGFQKVAKNFEHCFSGAPKYGNLNGSINDASS 59