BLASTX nr result
ID: Mentha25_contig00050031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00050031 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17700.1| hypothetical protein MIMGU_mgv1a001718mg [Mimulus... 60 2e-07 >gb|EYU17700.1| hypothetical protein MIMGU_mgv1a001718mg [Mimulus guttatus] Length = 769 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 2/70 (2%) Frame = +2 Query: 95 QPVSSATPNFKCNSELNVADISHNKNKKDHGTWKQRGSA-DSSQVK-VARTGPSSTPEPT 268 QPV S + E+N D+SHNK+KK+ GTWKQRGS+ DSS VK A PS E T Sbjct: 379 QPVISMAAHVGSTVEINEGDVSHNKHKKELGTWKQRGSSTDSSHVKGGAHVEPSLKSELT 438 Query: 269 KEIQQTNELV 298 K+++Q+ + V Sbjct: 439 KDVKQSKDSV 448