BLASTX nr result
ID: Mentha25_contig00049901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00049901 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37329.1| hypothetical protein MIMGU_mgv1a008932mg [Mimulus... 56 6e-06 >gb|EYU37329.1| hypothetical protein MIMGU_mgv1a008932mg [Mimulus guttatus] Length = 358 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -2 Query: 350 YKPFTYADFQAEKELDLKKVGMKIGLPRFR 261 Y+PF+YADFQA+KE+DLK +G+KIGLPRFR Sbjct: 324 YEPFSYADFQAKKEIDLKTIGIKIGLPRFR 353