BLASTX nr result
ID: Mentha25_contig00049844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00049844 (488 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ65409.1| hypothetical protein BGT96224_Ac30496 [Blumeria g... 59 9e-07 >gb|EPQ65409.1| hypothetical protein BGT96224_Ac30496 [Blumeria graminis f. sp. tritici 96224] Length = 294 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/78 (33%), Positives = 49/78 (62%) Frame = -2 Query: 418 MPPKKDDRRTQQNIEALKATTENVASAAAGLRREYSSFVERFESSKKPAQSGATLEDVSD 239 MP ++DD+R +QN+EA + +TEN+ ++ ++++YS FV R K+ ++ A L+ + D Sbjct: 1 MPDERDDKRVEQNMEAFRVSTENIKISSDSVQKQYSIFVGRMTDIKQLPEAKAILDQLED 60 Query: 238 SLDRLVGAAENHAMAIRA 185 +L V A E++ + A Sbjct: 61 ALGNFVKAIESYTCTLSA 78