BLASTX nr result
ID: Mentha25_contig00049794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00049794 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74485.1| hypothetical protein M569_00274, partial [Genlise... 63 4e-08 >gb|EPS74485.1| hypothetical protein M569_00274, partial [Genlisea aurea] Length = 80 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -3 Query: 353 PSIVLCSKLYRFSRPGLSTTQPSLRKTIFILFLRIEHGHR 234 PSIVLCSKLYRFSRP LST QPSLRK I IL +RI GH+ Sbjct: 10 PSIVLCSKLYRFSRPELSTPQPSLRKPISILLVRIADGHK 49