BLASTX nr result
ID: Mentha25_contig00049611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00049611 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015505.1| Cysteine proteinases superfamily protein [Th... 57 3e-06 >ref|XP_007015505.1| Cysteine proteinases superfamily protein [Theobroma cacao] gi|508785868|gb|EOY33124.1| Cysteine proteinases superfamily protein [Theobroma cacao] Length = 228 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 303 SEANKDVEDLWFSTMKEEVTPSLVSKMRHEILDLVRSLMAK 181 S NKD DLW S +KE+VTPS+VS+MR EIL L++ LMAK Sbjct: 187 SSENKDATDLWLSAVKEQVTPSVVSEMRKEILGLIKDLMAK 227