BLASTX nr result
ID: Mentha25_contig00049411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00049411 (427 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006384814.1| hypothetical protein POPTR_0004s21310g [Popu... 62 1e-07 ref|XP_006384813.1| hypothetical protein POPTR_0004s21310g [Popu... 62 1e-07 ref|XP_006384815.1| hypothetical protein POPTR_0004s21320g [Popu... 58 2e-06 ref|XP_002312817.2| hypothetical protein POPTR_0009s16560g [Popu... 55 1e-05 >ref|XP_006384814.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] gi|550341582|gb|ERP62611.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] Length = 190 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +2 Query: 2 EEVS--VVIPEKWGQENLLKDWIDYSTFDELLAPKEAGS 112 EEV+ V+IP+ WGQENLLKDWID STFDELLAPKE S Sbjct: 129 EEVAGRVMIPDTWGQENLLKDWIDCSTFDELLAPKEISS 167 >ref|XP_006384813.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] gi|550341581|gb|ERP62610.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa] Length = 147 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = +2 Query: 2 EEVS--VVIPEKWGQENLLKDWIDYSTFDELLAPKEAGS 112 EEV+ V+IP+ WGQENLLKDWID STFDELLAPKE S Sbjct: 88 EEVAGRVMIPDTWGQENLLKDWIDCSTFDELLAPKEISS 126 >ref|XP_006384815.1| hypothetical protein POPTR_0004s21320g [Populus trichocarpa] gi|550341583|gb|ERP62612.1| hypothetical protein POPTR_0004s21320g [Populus trichocarpa] Length = 159 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/35 (77%), Positives = 31/35 (88%), Gaps = 2/35 (5%) Frame = +2 Query: 2 EEVS--VVIPEKWGQENLLKDWIDYSTFDELLAPK 100 EEVS V+IP+ WGQENLL DWIDYS+FD+LLAPK Sbjct: 96 EEVSGKVMIPDTWGQENLLTDWIDYSSFDKLLAPK 130 >ref|XP_002312817.2| hypothetical protein POPTR_0009s16560g [Populus trichocarpa] gi|550331870|gb|EEE86772.2| hypothetical protein POPTR_0009s16560g [Populus trichocarpa] Length = 159 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 2/34 (5%) Frame = +2 Query: 2 EEVS--VVIPEKWGQENLLKDWIDYSTFDELLAP 97 EEVS V+IPE WGQE+LL DWIDYS+FD+LLAP Sbjct: 100 EEVSGKVMIPETWGQEDLLTDWIDYSSFDKLLAP 133