BLASTX nr result
ID: Mentha25_contig00049222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00049222 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007289364.1| hypothetical protein MBM_01475 [Marssonina b... 60 2e-07 gb|EPQ67567.1| hypothetical protein BGT96224_Ac31218 [Blumeria g... 56 5e-06 >ref|XP_007289364.1| hypothetical protein MBM_01475 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867755|gb|EKD20793.1| hypothetical protein MBM_01475 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 565 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/67 (46%), Positives = 44/67 (65%) Frame = -3 Query: 273 PQIRQSPQSVIVKDTKCLSVEVENFKNWARDLILDQQKDIGRLSGTISGIEREMQSIKNL 94 P R +P SV V E+ FKNWA D IL QQKDI R++GT++ I+++MQS+K Sbjct: 165 PSDRAAPLSVSV-------AEIVKFKNWAEDAILTQQKDIERITGTVNRIDQDMQSLKAF 217 Query: 93 LQEVKTE 73 + EV++E Sbjct: 218 MLEVRSE 224 >gb|EPQ67567.1| hypothetical protein BGT96224_Ac31218 [Blumeria graminis f. sp. tritici 96224] Length = 574 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/73 (41%), Positives = 43/73 (58%) Frame = -3 Query: 219 SVEVENFKNWARDLILDQQKDIGRLSGTISGIEREMQSIKNLLQEVKTESKTYHRNKEDA 40 S E+E FK WA D I +Q+ DI R+SGT+ IE ++Q +K + EV+ Sbjct: 115 SAEIEKFKYWAEDTIREQRLDIDRISGTMLRIEGDVQMLKEFMLEVRMNLALNLMPSAHE 174 Query: 39 KELVDMRNEIKQV 1 +L ++RNEIKQV Sbjct: 175 FKLDEVRNEIKQV 187