BLASTX nr result
ID: Mentha25_contig00049146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00049146 (518 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE31868.1| TPR-like protein [Glarea lozoyensis ATCC 20868] 60 3e-07 >gb|EPE31868.1| TPR-like protein [Glarea lozoyensis ATCC 20868] Length = 678 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -3 Query: 183 NSPQLPFGLDS-HPLNLPPDQRRQFSALSKMPDPERMDEDTEVPNAGLTPSPRAK 22 NSP+ PF + HPLNLP DQ R+FSALS M DP+RMD D+E A ++P P+ K Sbjct: 84 NSPRHPFDPSTTHPLNLPVDQLRRFSALSAMSDPDRMDIDSEPQAAPVSPPPQPK 138