BLASTX nr result
ID: Mentha25_contig00049136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00049136 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25969.1| hypothetical protein MIMGU_mgv1a001127mg [Mimulus... 65 1e-08 gb|EPS63126.1| ubiquitin carboxyl-terminal hydrolase, partial [G... 57 3e-06 >gb|EYU25969.1| hypothetical protein MIMGU_mgv1a001127mg [Mimulus guttatus] Length = 882 Score = 65.1 bits (157), Expect = 1e-08 Identities = 34/54 (62%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -2 Query: 159 NQSLYLVPFRWWQEAQGPSSSEVKRGI-XXXXXXXXXXXPMKIFNNIFNSDIAF 1 +Q +YLVPFRWW+EAQ PS SEVK GI PMKIFNNIFNSDI+F Sbjct: 48 DQRVYLVPFRWWKEAQDPSLSEVKNGIPYAACPAPPYGGPMKIFNNIFNSDISF 101 >gb|EPS63126.1| ubiquitin carboxyl-terminal hydrolase, partial [Genlisea aurea] Length = 790 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/53 (49%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = -2 Query: 159 NQSLYLVPFRWWQEAQGPSSSEVKRGI-XXXXXXXXXXXPMKIFNNIFNSDIA 4 +Q +YLVPFRWW++AQ PSS+++++G+ P+K+FN+IFNSDIA Sbjct: 12 DQRVYLVPFRWWKDAQEPSSTQLRKGVPYVASPASPFGGPLKLFNSIFNSDIA 64