BLASTX nr result
ID: Mentha25_contig00049082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00049082 (736 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EHY51766.1| hypothetical protein HMPREF1120_11008 (mitochondr... 84 7e-14 >gb|EHY51766.1| hypothetical protein HMPREF1120_11008 (mitochondrion) [Exophiala dermatitidis NIH/UT8656] Length = 77 Score = 83.6 bits (205), Expect = 7e-14 Identities = 45/72 (62%), Positives = 50/72 (69%) Frame = -2 Query: 339 SNSKAA*GLLVYLEVNCICTVIPXXXXXXXXXXXXXXXIHARPHLTAKVFRYLRTLIGKA 160 SNSKAA GLLVYLEV+ ICT IP IHARPHLTA+VFRYLRTLIGKA Sbjct: 6 SNSKAAKGLLVYLEVSSICTAIPISLSQSSRQLLYRYIIHARPHLTARVFRYLRTLIGKA 65 Query: 159 AIDRGFHQNQAY 124 A+ RGF Q+ + Sbjct: 66 AVCRGFLQSLTF 77