BLASTX nr result
ID: Mentha25_contig00048820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00048820 (851 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22904.1| hypothetical protein MIMGU_mgv1a017909mg, partial... 45 3e-09 >gb|EYU22904.1| hypothetical protein MIMGU_mgv1a017909mg, partial [Mimulus guttatus] Length = 462 Score = 45.1 bits (105), Expect(2) = 3e-09 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +2 Query: 275 RPNEMTVASKAVHPLPRSSHSTNHSSVGQTRSDSAS 382 R NE TVAS+ +HP P +SH N GQ RSDSA+ Sbjct: 206 RANETTVASRGIHPQPHASHLANQPRAGQIRSDSAN 241 Score = 43.5 bits (101), Expect(2) = 3e-09 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +3 Query: 102 PAA*VHANPQLSDKSQRLEELAIKQSR 182 P A VH + QLSDKSQRLEELAIKQSR Sbjct: 152 PVARVHPSSQLSDKSQRLEELAIKQSR 178