BLASTX nr result
ID: Mentha25_contig00048694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00048694 (775 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB58678.1| hypothetical protein L484_003934 [Morus notabilis] 60 1e-06 >gb|EXB58678.1| hypothetical protein L484_003934 [Morus notabilis] Length = 78 Score = 59.7 bits (143), Expect = 1e-06 Identities = 31/37 (83%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = -2 Query: 327 LDQFPEALEIQTGSEIYGA-LRFANKEVILDNFPFLP 220 LDQFPEALEIQTGSE + LRFANKEVILD+FPFLP Sbjct: 42 LDQFPEALEIQTGSENHWRDLRFANKEVILDDFPFLP 78