BLASTX nr result
ID: Mentha25_contig00048608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00048608 (425 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35493.1| hypothetical protein MIMGU_mgv1a0102462mg, partia... 62 1e-07 >gb|EYU35493.1| hypothetical protein MIMGU_mgv1a0102462mg, partial [Mimulus guttatus] Length = 130 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -3 Query: 135 SIHNLQASSTWKDFTELSAVYAPRGNRIFVHGAPWVVLRSRRLSV 1 SIHN+QA+S WKDFT+LS +YAPRG VH AP V +RRLS+ Sbjct: 3 SIHNVQANSIWKDFTDLSTIYAPRGKPTLVHAAPRPVSGTRRLSI 47