BLASTX nr result
ID: Mentha25_contig00048581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00048581 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q8LPB4.1|PSKR1_DAUCA RecName: Full=Phytosulfokine receptor 1;... 56 6e-06 ref|XP_006395801.1| hypothetical protein EUTSA_v10003581mg [Eutr... 56 6e-06 >sp|Q8LPB4.1|PSKR1_DAUCA RecName: Full=Phytosulfokine receptor 1; Short=DcPSKR1; AltName: Full=Phytosulfokine LRR receptor kinase 1; Flags: Precursor gi|21623969|dbj|BAC00995.1| phytosulfokine receptor [Daucus carota] Length = 1021 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 360 EMLTILEIACLCLSENPKMRPCTLKLVSWLENIGSDS 250 EML +LEIAC CL ENPK RP T +LVSWLENI S Sbjct: 985 EMLLVLEIACRCLGENPKTRPTTQQLVSWLENIDVSS 1021 >ref|XP_006395801.1| hypothetical protein EUTSA_v10003581mg [Eutrema salsugineum] gi|557092440|gb|ESQ33087.1| hypothetical protein EUTSA_v10003581mg [Eutrema salsugineum] Length = 1016 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -3 Query: 360 EMLTILEIACLCLSENPKMRPCTLKLVSWLENI 262 EML +LE+ACLCLSENPK RP T +LVSWL+++ Sbjct: 984 EMLRVLEVACLCLSENPKQRPTTQELVSWLDDV 1016