BLASTX nr result
ID: Mentha25_contig00046924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00046924 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33627.1| hypothetical protein MIMGU_mgv1a014616mg [Mimulus... 57 3e-06 >gb|EYU33627.1| hypothetical protein MIMGU_mgv1a014616mg [Mimulus guttatus] Length = 184 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/46 (54%), Positives = 28/46 (60%) Frame = -3 Query: 138 MGFSAPTAPFRPSSLCPPYFWFCRSCIHXXXXXXXSRVYCRLEDKA 1 MGFS + FRPSS PPYFWFCRS R +CRLED+A Sbjct: 1 MGFSPQSTHFRPSSFRPPYFWFCRSSTQFSPFSTSGRTFCRLEDRA 46