BLASTX nr result
ID: Mentha25_contig00046649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00046649 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45997.1| hypothetical protein MIMGU_mgv1a000110mg [Mimulus... 57 3e-06 >gb|EYU45997.1| hypothetical protein MIMGU_mgv1a000110mg [Mimulus guttatus] Length = 1759 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/52 (53%), Positives = 34/52 (65%), Gaps = 6/52 (11%) Frame = +3 Query: 330 ISILVGPLVTGYEDSTKDLSE------FHNVAVDWLKKTVSFPPLNTWHTGE 467 ++ILV PL G ED T DLS+ HNV VDWL +TV FP L+TW +GE Sbjct: 1065 MNILVRPLSIGAEDRTNDLSDPYSESKLHNVTVDWLNRTVCFPSLSTWQSGE 1116